From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004997000
  • symbol?: pmtC
  • description?: ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • ABC transporter ATP-binding protein
    • ABC superfamily ATP binding cassette transporter, ABC protein
    • ABC transporter family protein
    • putative ABC transporter ATP-binding protein
    • transport protein
  • strand?: -
  • coordinates?: 5178934..5179806
  • synteny block?: BlockID0038780
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1889
    08BA02176:
    C248_2018
    11819-97:
    MS7_1966
    71193:
    ST398NM01_2052
    ECT-R 2:
    ECTR2_1803
    ED133:
    SAOV_2033
    ED98:
    SAAV_1998
    HO 5096 0412:
    SAEMRSA15_18470
    JH1:
    SaurJH1_2021
    JH9:
    SaurJH9_1988
    JKD6008:
    SAA6008_01965
    JKD6159:
    SAA6159_01862
    LGA251:
    SARLGA251_18150
    M013:
    M013TW_1968
    MRSA252:
    SAR2023
    MSHR1132:
    SAMSHR1132_17750
    MSSA476:
    SAS1855
    Mu3:
    SAHV_1916
    Mu50:
    SAV1931
    MW2:
    MW1872
    RF122:
    SAB1867c
    ST398:
    SAPIG2052
    T0131:
    SAT0131_02061
    TCH60:
    HMPREF0772_11210
    TW20:
    SATW20_19250
    USA300_TCH1516:
    USA300HOU_1934
    VC40:
    SAVC_08915

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKLEHITKKYGSNVVLNDIDFDFGDSRIVGLIGKNGVGKTTVMKVMNGNIIKFDGKVDID
    N315            MKLEHITKKYGSNVVLNDIDFDFGDSRIVGLIGKNGVGKTTIMKVMNGNIIKFDGKVDID
    NCTC8325        MKLEHITKKYGSNVVLNDIDFDFGDSRIVGLIGKNGVGKTTVMKVMNGNIIKFDGKVDID
    Newman          MKLEHITKKYGSNVVLNDIDFDFGDSRIVGLIGKNGVGKTTVMKVMNGNIIKFDGKVDID
    USA300_FPR3757  MKLEHITKKYGSNVVLNDIDFDFGDSRIVGLIGKNGVGKTTVMKVMNGNIIKFDGKVDID
                    *****************************************:******************

    COL             NADNIGFLIEHPKLYDNKSGLYNLKLFAQVLGKGFDKAYTDKIIDAFGMRPYIKKKVKKY
    N315            NADNIGFLIEHPKLYDNKSGLYNLKLFAQVLGKGFDKAYTDKIIDAFGMRPYIKKKVKKY
    NCTC8325        NADNIGFLIEHPKLYDNKSGLYNLKLFAQVLGKGFDKAYTDKIIDAFGMRPYIKKKVKKY
    Newman          NADNIGFLIEHPKLYDNKSGLYNLKLFAQVLGKGFDKAYTDKIIDAFGMRPYIKKKVKKY
    USA300_FPR3757  NADNIGFLIEHPKLYDNKSGLYNLKLFAQVLGKGFDKAYTDKIIDAFGMRPYIKKKVKKY
                    ************************************************************

    COL             SMGMKQKLAIAVSLMNKPKFLILDEPTNGMDPDGSIDVLTTIKSLVNELDMRILISSHKL
    N315            SMGMKQKLAIAVSLMNKPKFLILDEPTNGMDPDGSIDVLTTIKSLVNELDMRILISSHKL
    NCTC8325        SMGMKQKLAIAVSLMNKPKFLILDEPTNGMDPDGSIDVLTTIKSLVNELDMRILISSHKL
    Newman          SMGMKQKLAIAVSLMNKPKFLILDEPTNGMDPDGSIDVLTTIKSLVNELDMRILISSHKL
    USA300_FPR3757  SMGMKQKLAIAVSLMNKPKFLILDEPTNGMDPDGSIDVLTTIKSLVNELDMRILISSHKL
                    ************************************************************

    COL             EDIELICDRAVFLRDGHFVQDVNMEEGVASDTTIVTVDHKDFDRTEKYLAEHFQLQNVDK
    N315            EDIELICDRAVFLRDGHFVQDVNMEVGVASDTTIVTVDHKDFDRTEKYLAEHFQLQNVDK
    NCTC8325        EDIELICDRAVFLRDGHFVQDVNMEEGVASDTTIVTVDHKDFDRTEKYLAEHFQLQNVDK
    Newman          EDIELICDRAVFLRDGHFVQDVNMEEGVASDTTIVTVDHKDFDRTEKYLAEHFQLQNVDK
    USA300_FPR3757  EDIELICDRAVFLRDGHFVQDVNMEEGVASDTTIVTVDHKDFDRTEKYLAEHFQLQNVDK
                    ************************* **********************************

    COL             ADGHLMINAQKNYQVILKALSELDIYPKYIETRKSSLRDTYFNINQRGDK
    N315            ADGHLMINAQKNYQVILKALSELDIYPKYIETRKSSLRDTYFNINQRGDK
    NCTC8325        ADGHLMINAQKNYQVILKALSELDIYPKYIETRKSSLRDTYFNINQRGDK
    Newman          ADGHLMINAQKNYQVILKALSELDIYPKYIETRKSSLRDTYFNINQRGDK
    USA300_FPR3757  ADGHLMINAQKNYQVILKALSELDIYPKYIETRKSSLRDTYFNINQRGDK
                    **************************************************