From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004999000
  • symbol?: pmtA
  • description?: ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • ABC transporter ATP-binding protein
    • ABC superfamily ATP binding cassette transporter, ABC protein
    • ABC transporter, ATP-binding protein
    • ABC transporter family protein
    • ABC transporter protein
    • multidrug ABC transporter ATPase
    • putative ABC transporter ATP-binding protein
  • strand?: -
  • coordinates?: 5180484..5181380
  • synteny block?: BlockID0038800
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1891
    08BA02176:
    C248_2020
    11819-97:
    MS7_1968
    71193:
    ST398NM01_2054
    ECT-R 2:
    ECTR2_1805
    ED133:
    SAOV_2035
    ED98:
    SAAV_2000
    HO 5096 0412:
    SAEMRSA15_18490
    JH1:
    SaurJH1_2023
    JH9:
    SaurJH9_1990
    JKD6008:
    SAA6008_01963
    JKD6159:
    SAA6159_01864
    LGA251:
    SARLGA251_18170
    M013:
    M013TW_1970
    MRSA252:
    SAR2025
    MSHR1132:
    SAMSHR1132_17770
    MSSA476:
    SAS1857
    Mu3:
    SAHV_1918
    Mu50:
    SAV1933
    MW2:
    MW1874
    RF122:
    SAB1869c
    ST398:
    SAPIG2054
    T0131:
    SAT0131_02063
    TCH60:
    HMPREF0772_11208
    TW20:
    SATW20_19270
    USA300_TCH1516:
    USA300HOU_1936
    VC40:
    SAVC_08925

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNAIELSNVNYSSDQFNLKNISFKVPQGFVTGFIGRNGAGKTTIIRLIMDLYQPQTGVIR
    N315            MNAIELSNVNYSSDQFNLKNISFKVPQGFVTGFIGRNGAGKTTIIRLIMDLYQPQTGVIR
    NCTC8325        MNAIELSNVNYSSDQFNLKNISFKVPQGFVTGFIGRNGAGKTTIIRLIMDLYQPQTGVIR
    Newman          MNAIELSNVNYSSDQFNLKNISFKVPQGFVTGFIGRNGAGKTTIIRLIMDLYQPQTGVIR
    USA300_FPR3757  MNAIELSNVNYSSDQFNLKNISFKVPQGFVTGFIGRNGAGKTTIIRLIMDLYQPQTGVIR
                    ************************************************************

    COL             VLEEDMALNPIELKNRIGFVYSENYFNERWTTKQLEKMIAPFYRKWDHQVFEFYLEKFDL
    N315            VLEEDMALNPIELKNSIGFVYSENYFNERWTTKQLEKMIAPFYRKWDHQVFEFYLEKFDL
    NCTC8325        VLEEDMALNPIELKNRIGFVYSENYFNERWTTKQLEKMIAPFYRKWDHQVFEFYLEKFDL
    Newman          VLEEDMALNPIELKNRIGFVYSENYFNERWTTKQLEKMIAPFYRKWDHQVFEFYLEKFDL
    USA300_FPR3757  VLEEDMALNPIELKNRIGFVYSENYFNERWTTKQLEKMIAPFYRKWDHQVFEFYLEKFDL
                    *************** ********************************************

    COL             PINKSIKTFSTGMKMKLSLAVAFSHHAELYIFDEPTSGLDPLARNELLEIIQQELIDENK
    N315            PINKSIKTFSTGMKMKLSLAVAFSHHAELYIFDEPTSGLDPLARNELLEIIQQELIDENK
    NCTC8325        PINKSIKTFSTGMKMKLSLAVAFSHHAELYIFDEPTSGLDPLARNELLEIIQQELIDENK
    Newman          PINKSIKTFSTGMKMKLSLAVAFSHHAELYIFDEPTSGLDPLARNELLEIIQQELIDENK
    USA300_FPR3757  PINKSIKTFSTGMKMKLSLAVAFSHHAELYIFDEPTSGLDPLARNELLEIIQQELIDENK
                    ************************************************************

    COL             TIFMSTHIISDLEKIADYIIHLSDGEVILNGSKEQLLQRYQVVSGAIEDLDDELASLLIY
    N315            TIFMSTHIISDLEKIADYIIHLSDGEVILNGSKEQLLQRYQVVSGATEDLDDELASLLIY
    NCTC8325        TIFMSTHIISDLEKIADYIIHLSDGEVILNGSKEQLLQRYQVVSGAIEDLDDELASLLIY
    Newman          TIFMSTHIISDLEKIADYIIHLSDGEVILNGSKEQLLQRYQVVSGAIEDLDDELASLLIY
    USA300_FPR3757  TIFMSTHIISDLEKIADYIIHLSDGEVILNGSKEQLLQRYQVVSGAIEDLDDELASLLIY
                    ********************************************** *************

    COL             EEHKRTGFIGLTEHAQVFKEILGHKVNITTPSIENLMVYLEKRKPKYHENIKLMEEGF
    N315            EEHKRTGFIGLTEHAQVFKEILGHKVNITTPSIENLMVYLEKRKPKYHENIKLMEEGF
    NCTC8325        EEHKRTGFIGLTEHAQVFKEILGHKVNITTPSIENLMVYLEKRKPKYHENIKLMEEGF
    Newman          EEHKRTGFIGLTEHAQVFKEILGHKVNITTPSIENLMVYLEKRKPKYHENIKLMEEGF
    USA300_FPR3757  EEHKRTGFIGLTEHAQVFKEILGHKVNITTPSIENLMVYLEKRKPKYHENIKLMEEGF
                    **********************************************************