From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN005022000
  • symbol?:
  • description?: peptidoglycan hydrolase

      descriptions from strain specific annotations:

    • peptidoglycan hydrolase
    • truncated phage amidase
    • truncated amidase
    • amidase (fragment)
    • pseudogene
    • SH3 domain-containing protein
    • SH3 domain protein
    • SH3 type 3 domain-containing protein
    • Truncated amidase, phage associated
  • strand?: -
  • coordinates?: 5195189..5195485
  • synteny block?: BlockID0039030
  • occurrence?: in 44% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1903 (lytA)
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ECTR2_1816
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_18600
    JH1:
    SaurJH1_2036
    JH9:
    SaurJH9_2001
    JKD6008:
    SAA6008_01954
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    SAR2037
    MSHR1132:
    MSSA476:
    Mu3:
    Mu50:
    MW2:
    RF122:
    ST398:
    T0131:
    SAT0131_02077
    TCH60:
    HMPREF0772_11196
    TW20:
    SATW20_19370
    USA300_TCH1516:
    USA300HOU_1948
    VC40:

Genome Viewer[edit source | edit]

NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    NCTC8325        MPAGYTLDKNNVPYKKETGYYTVANVKGNNVRDGYSTNSRITGVLPNNATIKYDGAYCIN
    Newman          MPAGYTLDKNNVPYKKETGYYTVANVKGNNVRDGYSTNSRITGVLPNNATIKYDGAYCIN
    USA300_FPR3757  MPAGYTLDKNNVPYKKETGYYTVANVKGNNVRDGYSTNSRITGVLPNNATIKYDGAYCIN
                    ************************************************************

    NCTC8325        GYRWITYIANSGQRRYIATGEVDKAGNRISSFGKFSAV
    Newman          GYRWITYIANSGQRRYIATGEVDKAGNRISSFGKFSAV
    USA300_FPR3757  GYRWITYIANSGQRRYIATGEVDKAGNRISSFGKFSAV
                    **************************************