From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005029000
  • symbol?: ami
  • description?: lytic enzyme

      descriptions from strain specific annotations:

    • lytic enzyme
    • Autolysin
    • CHAP domain protein
    • phage amidase
    • CHAP domain-containing protein
    • N-acetylmuramoyl-L-alanine amidase
    • CHAP protein
  • strand?: -
  • coordinates?: 5198406..5199161
  • synteny block?: BlockID0039100
  • occurrence?: in 69% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1906
    08BA02176:
    11819-97:
    MS7_1980
    71193:
    ECT-R 2:
    ECTR2_1818
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_18620
    JH1:
    SaurJH1_2038
    JH9:
    SaurJH9_2003
    JKD6008:
    SAA6008_01952 (ami)
    JKD6159:
    SAA6159_01876 (ami)
    LGA251:
    M013:
    MRSA252:
    SAR2040
    MSHR1132:
    SAMSHR1132_17880
    MSSA476:
    SAS1869
    Mu3:
    SAHV_1931
    Mu50:
    SAV1945
    MW2:
    MW1886
    RF122:
    ST398:
    T0131:
    SAT0131_02079
    TCH60:
    HMPREF0772_11194 (amiD4)
    TW20:
    SATW20_19390
    USA300_TCH1516:
    USA300HOU_1951 (ami)
    VC40:

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MKTYSEARARLRWYQGRYIDFDGWYGYQCADLAVDYIYWLLEIRMWGNAKDAINNDFKNM
    NCTC8325        MKTYSEARARLRWYQGRYIDFDGWYGYQCADLAVDYIYWLLEIRMWGNAKDAINNDFKNM
    Newman          MKTYSEARARLRWYQGRYIDFDGWYGYQCADLAVDYIYWLLEIRMWGNAKDAINNDFKNM
    USA300_FPR3757  MKTYSEARARLRWYQGRYIDFDGWYGYQCADLAVDYIYWLLEIRMWGNAKDAINNDFKNM
                    ************************************************************

    N315            ATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNANTPAKL
    NCTC8325        ATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNANTPAKL
    Newman          ATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNANTPAKL
    USA300_FPR3757  ATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFLILEQNYDGNANTPAKL
                    ************************************************************

    N315            RWDNYYGCTHFIRPKYKSEGLMNKITNKINPPAQKAVGKSASKITVGSKAPYNLKWSKGA
    NCTC8325        RWDNYYGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKITVGSKAPYNLKWSKGA
    Newman          RWDNYYGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKITVGSKAPYNLKWSKGA
    USA300_FPR3757  RWDNYYGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASKITVGSKAPYNLKWSKGA
                    ****************************::******************************

    N315            YFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDGWCRIYWNNHNEWI
    NCTC8325        YFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDGWCRIYWNNHNEWI
    Newman          YFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDGWCRIYWNNHNEWI
    USA300_FPR3757  YFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVFEIIDGWCRIYWNNHNEWI
                    ************************************************************

    N315            WHERLIVKEAF
    NCTC8325        WHERLIVKEVF
    Newman          WHERLIVKEVF
    USA300_FPR3757  WHERLIVKEVF
                    *********.*