From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005044000
  • symbol?:
  • description?: phi77 ORF109-like protein

      descriptions from strain specific annotations:

    • phi77 ORF109-like protein
    • phage protein
  • strand?: -
  • coordinates?: 5205407..5205559
  • synteny block?: BlockID0039220
  • occurrence?: in 69% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1913
    08BA02176:
    11819-97:
    MS7_1984
    71193:
    ST398NM01_2916
    ECT-R 2:
    ECTR2_1824
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_18670
    JH1:
    SaurJH1_2043
    JH9:
    SaurJH9_2007
    JKD6008:
    SAA6008_02005
    JKD6159:
    SAA6159_01881
    LGA251:
    M013:
    MRSA252:
    SAR2047
    MSHR1132:
    SAMSHR1132_17920
    MSSA476:
    SAS1875
    Mu3:
    SAHV_1938
    Mu50:
    SAV1952
    MW2:
    MW1892
    RF122:
    ST398:
    T0131:
    SAT0131_02084 (ssp)
    TCH60:
    HMPREF0772_11189
    TW20:
    SATW20_19440
    USA300_TCH1516:
    USA300HOU_1956
    VC40:

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MNDSNQGLQANPQYTIHYLSQEITRLTQENAMLKAYIQEQNEKSKSAEEE
    NCTC8325        MQDNKQGLQANPEYTIHYLSQEIMRLTQENAMLKAYIQENKENQQCAEEE
    USA300_FPR3757  MQDNKQGLQANPEYTIHYLSQEIMRLTQENAMLKAYIQENKENQQCAEEE
                    *:*.:*******:********** ***************::*:.:.****