From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005045000
  • symbol?:
  • description?: phi PVL ORF 20 and 21-like protein

      descriptions from strain specific annotations:

    • phi PVL ORF 20 and 21-like protein
    • phi PVL ORF 20 and 21 homologue
    • phage protein
    • phage minor structural protein
    • Structural protein, phage associated
    • phage minor structural protein, N-terminal region domain protein
    • phage minor structural , N-terminal region domain protein
    • phi77 ORF002-like protein, phage minor structural protein
  • strand?: -
  • coordinates?: 5205546..5209404
  • synteny block?: BlockID0039230
  • occurrence?: in 72% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1914
    08BA02176:
    11819-97:
    MS7_1985
    71193:
    ST398NM01_2917
    ECT-R 2:
    ECTR2_1825
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_18680
    JH1:
    SaurJH1_2044
    JH9:
    SaurJH9_2008
    JKD6008:
    SAA6008_02006
    JKD6159:
    SAA6159_01882
    LGA251:
    M013:
    MRSA252:
    SAR2048
    MSHR1132:
    SAMSHR1132_17930
    MSSA476:
    SAS1876
    Mu3:
    SAHV_1939
    Mu50:
    SAV1953
    MW2:
    MW1893
    RF122:
    ST398:
    T0131:
    SAT0131_02085
    TCH60:
    HMPREF0772_11188
    TW20:
    SATW20_19450
    USA300_TCH1516:
    USA300HOU_1957
    VC40:

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MIHVLDFNDKIIDFLSTDDPSLVRAIHKRNVNDNSEMLELLISSERAEKFRERHRVIIRD
    NCTC8325        MIHVLDFNDKIIDFLSTDDPSLVRAIHKRNVNDNSEMLELLISSERAEKFRERHRVIIRD
    Newman          MIHVLDFNDKIIDFLSTDDPSLVRAIHKRNVNDNSEMLELLISSERAEKFRKRHRVIIRD
    USA300_FPR3757  MIHVLDFNDKIIDFLSTDDPSLVRAIHKRNVNDNSEMLELLISSERAEKFRERHRVIIRD
                    ***************************************************:********

    N315            SNKQWREFIINWVQDTMDGYTEIECIASYLADITTAKPYAPGKFEKKTTSEALKDVLSDT
    NCTC8325        SNKQWREFIINWVQDTMDGYTEIECIASYLADITTAKPYAPGKFEKKTTSEALKDVLSDT
    Newman          SNKQWREFIINWVQDTMDGYTEIECIASYLADITTAKPYAPGKFEKKTTSEALKDVLSDT
    USA300_FPR3757  SNKQWREFIINWVQDTMDGYTEIECIASYLADITTAKPYAPGKFEKKTTSEALKDVLSDT
                    ************************************************************

    N315            GWEVSEQTEYDGLRTTSWTSYQTRYEVLKQLCTTYKMVLDFYIELSSNTVKGRYVVLKKK
    NCTC8325        GWEVSEQTEYDGLRTTSWTSYQTRYEVLKQLCTTYKMALDFYIELSSNTVKGRYVVLKKK
    Newman          GWEVSEQTEYDGLRTTSWTSYQTRYEVLKQLCTTYKMVLDFYIELSSNTVKGRYVVLKKK
    USA300_FPR3757  GWEVSEQTEYDGLRTTSWTSYQTRYEVLKQLCTTYKMVLDFYIELSSNTVKGRYVVLKKK
                    *************************************.**********************

    N315            NSLFKGKEIEYGKDLVGLTRKIDMSEIKTALIAVGPENDKGKRLELVVTDDEAQSQFNLP
    NCTC8325        NSLFKGKEIEYGKDLVGLTRKIDMSEIKTALIAVGPENDKGKRLELVVTDDEAQSQFNLP
    Newman          NSLFKGKEIEYGKDLVGLTRKIDMSEIKTALIAVGPENDKGKRLELVVTDDEAQSQFNLP
    USA300_FPR3757  NSLFKGKEIEYGKDLVGLTRKIDMSEIKTALIAVGPENDKGKRLELVVTDDEAQSQFNLP
                    ************************************************************

    N315            MRYIWGIYEPQSDDQNMNETRLSSLAKTELNKRKSAVMSYEITSTDLEVTYPHEIISIGD
    NCTC8325        TRYIWGIYEPQSDDQNMNETRLRSLAKTELNKRKSAVMSYEITSTDLEVTYPHEIISIGD
    Newman          MRYIWGIYEPQSDDQNMNETRLSSLAKTELNKRKSAVMSYEITSTDLEVTYPHEIISIGD
    USA300_FPR3757  MRYIWGIYEPQSDDQNMNETRLSSLAKTELNKRKSAVMSYEITSTDLEVTYPHEIISIGD
                     ********************* *************************************

    N315            TVRVKHRDFNPPLYVEAEVIAEEYNIISENSTYTFGQPKEFKESELREEFNKRLNLIHQK
    NCTC8325        TVRVKHRDFNPPLYVEAEVIAEEYNIISENSTYTFGQPKEFKESELREEFNKRLNIIHQK
    Newman          TVRVKHRDFNPPLYVEAEVIAEEYNIISENSTYTFGQPKEFKESELREEFNKRLNLIHQK
    USA300_FPR3757  TVRVKHRDFNPPLYVEAEVIAEEYNIISENSTYTFGQPKEFKESELREEFNKRLNLIHQK
                    *******************************************************:****

    N315            LNDNISNINTIVKDVVDGELEYFERKIHKSDTPPENPVNDMLWYDTSNPDVAVLRRYWNG
    NCTC8325        LNDNISNINTIVKDVVDGELEYFERKIHKNDTPPENPVNDMLWYDTSNPDVAVLRRYWNG
    Newman          LNDNISNINTIVKDIVDGELEYFERKIHKSDTPPENPVNDTLWYDTSNPDVAVLRRYWNG
    USA300_FPR3757  LNDNISNINTIVKDVVDGELEYFERKIHKSDTPPENPVNDTLWYDTSNPDVAVLRRYWNG
                    **************:**************.********** *******************

    N315            RWIEATPNDVEKLGGITREKALFSELNNIFINLSIQHASLLSEATELLNSEYLVDNDLKA
    NCTC8325        RWIEATPNDVEKLGGITREKALFSELNNIFINLSIQHASLLSEATELLNSEYLVDNDLKA
    Newman          RWIEATPNDVEKLGGITREKALFSELNNIFINLSIQHASLLSEATELLNSEYLVDNDLKA
    USA300_FPR3757  RWIEATPNDVEKLGGITREKALFSELNNIFINLSIQHASLLSEATELLNSEYLVDNDLKA
                    ************************************************************

    N315            DLQASLDAVIDVYNQIKNNLESMTPETATIGRLVDTQALFLEYRKKLQDVYTDVEDVKIA
    NCTC8325        DLQASLDAVIDVYNQIKNNLESMTPETATIGRLVDTQALFLEYRKKLQDVYTDVEDVKIA
    Newman          DLQASLDAVIDVYNQIKNNLESMTPETATIGRLVDTKTLFLEYRKKLQDVYTDVEDVKIA
    USA300_FPR3757  DLQASLDAVIDVYNQIKNNLESMTPETATIGRLVDTKTLFLEYRKKLQDVYTDVEDVKIA
                    ************************************::**********************

    N315            ISDRFKLLQSQYTDEKYKEALEIIATKFGLTVNEDLQLVGEPNVVKSAIEAARESTKEQL
    NCTC8325        ISDRFKLLQSQYTDEKYKEALEIIATKFGLTVNEDLQLVGEPNVVKSAIEAARESTKEQL
    Newman          ISDRFKLLQSQYTDEKYKEALEIIATKFGLTVNEDLQLVGEPNVVKSAIEAARESTKEQL
    USA300_FPR3757  ISDRFKLLQSQYTDEKYKEALEIIATKFGLTVNEDLQLVGEPNVVKSAIEAARESTKEQL
                    ************************************************************

    N315            RDYVKTSDYKTDKDGIVERLDTAEAERTTLKGEIKDKVTLNEYRNGLEEQKQYTDDQLSD
    NCTC8325        RDYVKTSDYKTDKDGIVERLDTAEAERTTLKGEIKDKVTLNEYRNGLEEQKQYTDDQLSD
    Newman          RDYVKTSDYKTDKDGIVERLDTAEAERTTLKGEIKDKVTLNEYRNGLEEQKQYTDDQLSD
    USA300_FPR3757  RDYVKTSDYKTDKDGIVERLDTAEAERTTLKGEIKDKVTLNEYRNGLEEQKQYTDDQLSD
                    ************************************************************

    N315            LSNNPEIKASIEQANQEAQEALKSYIDAQDDLKEKESQAYADGKISEEEQRAIQDAQAKL
    NCTC8325        LSNNPEIKASIEQANQEAQEALKSYIDAQDNLKEKESQAYADGKISEEEQRAIQDAQAKL
    Newman          LSNNPEIKASIEQANQEAQEALKSYIDAQDDLKEKESQAYADGKISEEEQRAIQDAQAKL
    USA300_FPR3757  LSNNPEIKASIEQANQEAQEALKSYIDAQDNLKEKESQAYADGKISEEEQRAIQDAQAKL
                    ******************************:*****************************

    N315            EEAKQNAELKARNAEKKANAYTDNKVKESTDAQRKTLTRYGSQIIQNGKEIKLRTTKEEF
    NCTC8325        EEAKQNAELKARNAEKKANAYTDNKVKESTDAQRRTLTRYGSQIIQNGKEIKLRTTKEEF
    Newman          EEAKQNAELKARNAEKKANVYTDNKVKESTDAQRKTLTRYGSQIIQNGKEIKLRTTKEEF
    USA300_FPR3757  EEAKQNAELKARNAEKKANAYTDNKVKESTDAQRRTLTRYGSQIIQNGKEIKLRTTKEEF
                    *******************.**************:*************************

    N315            NASKRTLSRLLADITVNAMKGIYLRYDENGAITSHTIDKDGVKISGDKVDITANREFNVV
    NCTC8325        NATNRTLSNILNEIVQNVTDGTTIRYDDNGVAQALNVGPRGIRLNADKIDINGNREINLL
    Newman          NATNRTLSNILNEIVQNVTDGTTIRYDDNGVAQALNVGPRGIRLNADKIDINGNREINLL
    USA300_FPR3757  NATNRTLSNILNEIVQNVTDGTTIRYDDNGVAQALNVGPRGIRLNADKIDINGNREINLL
                    **::****.:* :*. *. .*  :***:**.  : .:.  *:::..**:**..***:*::

    N315            ANNINNKVGKNDIVNSLNLSNEGLDINVNRIGIKGGNANRYVQVQNDFIELGGIVQRTWK
    NCTC8325        IQNMRDKVDKTDIVNSLNLSREGLDINVNRIGIKGGNNNRYVQIQNDSIELGGIVQRTWK
    Newman          IQNMRDKVDKTDIVNSLNLSREGLDINVNRIGIKGGDNNRYVQIQNDSIELGGIVQRTWR
    USA300_FPR3757  IQNMRDKVDKTDIVNSLNLSREGLDINVNRIGIKGGNNNRYVQIQNDSIELGGIVQRTWK
                     :*:.:**.*.*********.***************: *****:*** ***********:

    N315            GKRSTDDIFTRLKDGHLRFRNNTAGGSLYMSHFGISTYIDGEGEDGGSSGTIQWWDKTYS
    NCTC8325        GKRSTDDIFTRLKDGHLRFRNNTAGGSLYMSHFGISTYIDGEGEDGGSSGTIQWWDKTYS
    Newman          GKRSTDDIFTRLKDGHLRFRNNTAGGSLYMSHFGISTYIDGEGEDGGSSGTIQWWDKTYS
    USA300_FPR3757  GKRSTDDIFTRLKDGHLRFRNNTAGGSLYMSHFGISTYIDGEGEDGGSSGTIQWWDKTYS
                    ************************************************************

    N315            DSGMNGITINSYGGVVALTSDYNRIIIDSYASANIESREAPIYLSPNTKNKPGLNRFAFT
    NCTC8325        DSGMNGITINSYGGVVALTSDNNRVVLESYASSNIKSKQAPVYLYPNTDKVPGLNRFAFT
    Newman          DSGMNGITINSYGGVVALTSDNNRVVLESYASSNIKSKQAPVYLYPNTDKVPGLNRFAFT
    USA300_FPR3757  DSGMNGITINSYGGVVALTSDNNRVVLESYASSNIKSKQAPVYLYPNTDKVPGLNRFAFT
                    ********************* **::::****:**:*::**:** ***.: *********

    N315            LSNADSAYETDGYIMFGSDENYKYGAGLRFSKRSNKGLVQVVNGDYATGGDTTIESGMGK
    NCTC8325        LSNADNAYSSDGYIMFGSDENYDYGAGIRFSKERNKGLVQIVNGRYATGGDTTIEAGYGK
    Newman          LSNADNAYSSDGYIMFGSDENYDYGAGIRFSKERNKGLVQIVNGRYATGGDTTIEAGYGK
    USA300_FPR3757  LSNADNAYSSDGYIMFGSDENYDYGAGIRFSKERNKGLVQIVNGRYATGGDTTIEAGYGK
                    *****.**.:************.****:****. ******:*** **********:* **

    N315            FNLVKRRDGNSYVSIQSYDLLAVGSDNAGDRVASNSIYKRTYSAPANLHITSAGTIGRAT
    NCTC8325        FNMLKRRDGNRYIHIQSTDLLSVGSDDAGDRIASNSIYRRTYSAAANLHITSAGTIGRST
    Newman          FNMLKRRDGNRYIHIQSTDLLSVGSDDAGDRIASNSIYRRTYSAAANLHITSAGTIGRST
    USA300_FPR3757  FNMLKRRDGNRYIHIQSTDLLSVGSDDAGDRIASNSIYRRTYSAAANLHITSAGTIGRST
                    **::****** *: *** ***:****:****:******:*****.*************:*

    N315            SAKKYKISIENQYINEDDQFSHSKEILKLPIRTWFDKYESEIMAKELESGKKLSDDTFKL
    NCTC8325        SARKYKLSIENQYNDRDEQLEHSKAILNLPIRTWFDKAESEILARELREDRKLSEDTYKL
    Newman          SARKYKLSIENQYNDRDEQLEHSKAILNLPIRTWFDKAESEILARELREDRKLSEDTYKL
    USA300_FPR3757  SARKYKLSIENQYNDRDEQLEHSKAILNLPIRTWFDKAESEILARELREDRKLSEDTYKL
                    **:***:****** :.*:*:.*** **:********* ****:*:**...:***:**:**

    N315            SRHTGLIAEEVEELGFNEFVIYDDNGEIEGIAYDRLWVHLIPIIKNQQSKIEKLEELINE
    NCTC8325        DRYVGLIAEEVENLGLKEFVTYDDKGEIEGIAYDRLWIHLIPVIKEQQLRIKKLEESKNA
    Newman          DRYVGLIAEEVENLGLKEFVTYDDKGEIEGIAYDRLWIHLIPVIKEQQLRIKKLEESKNA
    USA300_FPR3757  DRYVGLIAEEVENLGLKEFVTYDDKGEIEGIAYDRLWIHLIPVIKEQQLRIKKLEESKNA
                    .*:.********:**::*** ***:************:****:**:** :*:****  * 

    N315            -
    NCTC8325        G
    Newman          G
    USA300_FPR3757  G