From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN005101000
  • symbol?: ssb
  • description?: single-strand DNA-binding protein

      descriptions from strain specific annotations:

    • single-strand DNA-binding protein
    • single-strand binding protein
    • Single-stranded DNA-binding protein, phage associated
    • ssDNA-binding protein
    • single-stranded DNA-binding protein ssb
    • putative single strand DNA-binding protein
    • phage single-strand DNA-binding protein
  • strand?: -
  • coordinates?: 5250795..5251265
  • synteny block?: BlockID0039570
  • occurrence?: in 50% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1944
    08BA02176:
    11819-97:
    MS7_2017
    71193:
    ST398NM01_2942
    ECT-R 2:
    ECTR2_1856 (ssb)
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_19060
    JH1:
    SaurJH1_2076
    JH9:
    SaurJH9_2039
    JKD6008:
    JKD6159:
    SAA6159_01918 (ssb2)
    LGA251:
    M013:
    MRSA252:
    SAR2083
    MSHR1132:
    SAMSHR1132_18250
    MSSA476:
    SAS1904
    Mu3:
    SAHV_1969
    Mu50:
    SAV1983
    MW2:
    MW1921
    RF122:
    ST398:
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    VC40:

Genome Viewer[edit source | edit]

N315 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAEN
    Newman          MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAEN
                    ************************************************************

    N315            VNKYLSKGSLAGVDGRLQTRNYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQV
    Newman          VNKYLSKGSLAGVDGRLQTRNYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQV
                    ***********************************:************************

    N315            QQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
    Newman          QQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
                    ****************************::*:****