From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005190000
  • symbol?: lukG
  • description?: gamma-hemolysin subunit B

      descriptions from strain specific annotations:

    • gamma-hemolysin subunit B
    • leukocidin subunit precursor
    • leukocidin/hemolysin toxin subunit F
    • leukocidin/hemolysin toxin family protein
    • leukocidin F subunit
    • beta-channel forming cytolysin
    • beta-channel forming cytolysin family protein
    • gamma-hemolysin component B
    • leukocidin-like protein 1
    • Leukocidin LukF-PV
    • leukocidin subunit precursor, putative
    • putative leukocidin F subunit
    • synergohymenotropic toxin
  • strand?: -
  • coordinates?: 5359637..5360512
  • synteny block?: BlockID0040220
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1927 (lukF)
    USA300_FPR3757:
    04-02981:
    SA2981_1966
    08BA02176:
    C248_2027
    11819-97:
    MS7_2036
    71193:
    ST398NM01_2060
    ECT-R 2:
    ECTR2_1876
    ED133:
    SAOV_2041
    ED98:
    SAAV_2072
    HO 5096 0412:
    SAEMRSA15_19270
    JH1:
    SaurJH1_2099
    JH9:
    SaurJH9_2062
    JKD6008:
    SAA6008_02058
    JKD6159:
    SAA6159_01939
    LGA251:
    SARLGA251_18230
    M013:
    M013TW_1976
    MRSA252:
    SAR2107
    MSHR1132:
    SAMSHR1132_18470
    MSSA476:
    SAS1924
    Mu3:
    SAHV_1990
    Mu50:
    SAV2004
    MW2:
    MW1941
    RF122:
    SAB1875c
    ST398:
    SAPIG2060
    T0131:
    SAT0131_02140
    TCH60:
    HMPREF0772_11178
    TW20:
    SATW20_20010
    USA300_TCH1516:
    USA300HOU_2011
    VC40:
    SAVC_08965

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ------------------------------------------------MYTRTATTSDSQ
    N315            MIKQLYKNITICSLAISTALTVFPATSYAKINSEIKAVSEKNLDGDTKMYTRTATTSDSQ
    NCTC8325        MIKQLCKNITICTLALSTTFTVLPATSFAKINSEIKQVSEKNLDGDTKMYTRTATTSDSQ
    Newman          MIKQLCKNITICTLALSTTFTVLPATSFAKINSEIKQVSEKNLDGDTKMYTRTATTSDSQ
    USA300_FPR3757  MIKQLCKNITICTLALSTTFTVLPATSFAKINSEIKQVSEKNLDGDTKMYTRTATTSDSQ
                                                                    ************

    COL             KNITQSLQFNFLTEPNYDKETVFIKAKGTIGSGLRILDPNGYWNSTLRWPGSYSVSIQNV
    N315            KNITQSLQFNFLTEPNYDKETVFIKAKGTIGSGLRILDPNGYWNSTLRWPGSYSVSIQNV
    NCTC8325        KNITQSLQFNFLTEPNYDKETVFIKAKGTIGSGLRILDPNGYWNSTLRWPGSYSVSIQNV
    Newman          KNITQSLQFNFLTEPNYDKETVFIKAKGTIGSGLRILDPNGYWNSTLRWPGSYSVSIQNV
    USA300_FPR3757  KNITQSLQFNFLTEPNYDKETVFIKAKGTIGSGLRILDPNGYWNSTLRWPGSYSVSIQNV
                    ************************************************************

    COL             DDNNNTNVTDFAPKNQDESREVKYTYGYKTGGDFSINRGGLTGNITKESNYSETISYQQP
    N315            DDNNNTNVTDFAPKNQDESREVKYTYGYKTGGDFSINRGGLTGNITKESNYSETISYQQP
    NCTC8325        DDNNNTNVTDFAPKNQDESREVKYTYGYKTGGDFSINRGGLTGNITKESNYSETISYQQP
    Newman          DDNNNTNVTDFAPKNQDESREVKYTYGYKTGGDFSINRGGLTGNITKESNYSETISYQQP
    USA300_FPR3757  DDNNNTNVTDFAPKNQDESREVKYTYGYKTGGDFSINRGGLTGNITKESNYSETISYQQP
                    ************************************************************

    COL             SYRTLLDQSTSHKGVGWKVEAHLINNMGHDHTRQLTNDSDNRTKSEIFSLTRNGNLWAKD
    N315            SYRTLLDQSTSHKGVGWKVEAHLINNMGHDHTRQLTNDSDNRTKSEIFSLTRNGNLWAKD
    NCTC8325        SYRTLLDQSTSHKGVGWKVEAHLINNMGHDHTRQLTNDSDNRTKSEIFSLTRNGNLWAKD
    Newman          SYRTLLDQSTSHKGVGWKVEAHLINNMGHDHTRQLTNDSDNRTKSEIFSLTRNGNLWAKD
    USA300_FPR3757  SYRTLLDQSTSHKGVGWKVEAHLINNMGHDHTRQLTNDSDNRTKSEIFSLTRNGNLWAKD
                    ************************************************************

    COL             NFTPKDKMPVTVSEGFNPEFLAVMSHDKKDKGKSQFVVHYKRSMDEFKIDWNRHGFWGYW
    N315            NFTPKDKMPVTVSEGFNPEFLAVMSHDKKDKGKSQFVVHYKRSMDEFKIDWNRHGFWGYW
    NCTC8325        NFTPKDKMPVTVSEGFNPEFLAVMSHDKKDKGKSQFVVHYKRSMDEFKIDWNRHGFWGYW
    Newman          NFTPKDKMPVTVSEGFNPEFLAVMSHDKKDKGKSQFVVHYKRSMDEFKIDWNRHGFWGYW
    USA300_FPR3757  NFTPKDKMPVTVSEGFNPEFLAVMSHDKKDKGKSQFVVHYKRSMDEFKIDWNRHGFWGYW
                    ************************************************************

    COL             SGENHVDKKEEKLSALYEVDWKTHNVKFVKVLNDNEKK
    N315            SGENHVDKKEEKLSALYEVDWKTHDVKFVKVLNDNEKK
    NCTC8325        SGENHVDKKEEKLSALYEVDWKTHNVKFVKVLNDNEKK
    Newman          SGENHVDKKEEKLSALYEVDWKTHNVKFVKVLNDNEKK
    USA300_FPR3757  SGENHVDKKEEKLSALYEVDWKTHNVKFVKVLNDNEKK
                    ************************:*************