From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005193000
  • symbol?:
  • description?: succinyl-diaminopimelate desuccinylase

      descriptions from strain specific annotations:

    • succinyl-diaminopimelate desuccinylase
    • Acetylornithine deacetylase
    • peptidase, ArgE/DapE family protein
    • probable succinyl-diaminopimelate desuccinylase (sdap)
    • pseudogene
    • putative peptidase
    • putative succinyl-diaminopimelate desuccinylase
  • strand?: +
  • coordinates?: 5362184..5363403
  • synteny block?: BlockID0040250
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1968
    08BA02176:
    C248_2029
    11819-97:
    MS7_2038 (dapE)
    71193:
    ST398NM01_2062
    ECT-R 2:
    ECTR2_1878
    ED133:
    SAOV_2043
    ED98:
    SAAV_2074
    HO 5096 0412:
    SAEMRSA15_19290
    JH1:
    SaurJH1_2101
    JH9:
    SaurJH9_2064
    JKD6008:
    SAA6008_02060 (argE)
    JKD6159:
    SAA6159_01941 (argE)
    LGA251:
    SARLGA251_18250
    M013:
    M013TW_1978
    MRSA252:
    SAR2109
    MSHR1132:
    SAMSHR1132_18490
    MSSA476:
    SAS1926
    Mu3:
    SAHV_1992
    Mu50:
    SAV2006
    MW2:
    MW1943
    RF122:
    SAB1877
    ST398:
    SAPIG2062
    T0131:
    SAT0131_02143
    TCH60:
    HMPREF0772_11176 (dapE)
    TW20:
    SATW20_20030
    USA300_TCH1516:
    USA300HOU_2014
    VC40:
    SAVC_08975

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            ---------------------MTTFSEKEKIQLLADIVELQTENNNEIDVCNYLKDLFDK
    NCTC8325        ---------------------MTTFSEKEKIQLLADIVELQTENNNEIDVCNYLTDLFDK
    Newman          MFKNKNYVYINIYTTLKGVSLMTTFSEKEKIQLLADIVELQTENNNEIDVCNYLTDLFDK
    USA300_FPR3757  ---------------------MTTFSEKEKIQLLADIVELQTENNNEIDVCNYLTDLFDK
                                         *********************************.*****

    N315            YDIKSEILKVNEHRANIVAEIGNGSPILALSGHMDVVDAGNQDNWTYPPFQLTEKAGKLY
    NCTC8325        YDIKSEILKVNEHRANIVAEIGNGSPILALSGHMDVVDAGNQDNWSYPPFQLTEKDGKLY
    Newman          YDIKSEILKVNEHRANIVAEIGNGSPILALSGHMDVVDAGNQDNWSYPPFQLTEKDGKLY
    USA300_FPR3757  YDIKSEILKVNEHRANIVAEIGNGSPILALSGHMDVVDAGNQDNWSYPPFQLTEKDGKLY
                    *********************************************:********* ****

    N315            GRGTTDMKGGLMALVITLIELKEQNQLPQGTIRLLATAGEEKEQEGAKLLADKGYLDDVD
    NCTC8325        GRGTTDMKGGLMALVVSLIELKEQNELPHGTIRLLATAGEEKEQEGAKLLADKGYLDDVD
    Newman          GRGTTDMKGGLMALVVSLIELKEQNELPHGTIRLLATAGEEKEQEGAKLLADKGYLDDVD
    USA300_FPR3757  GRGTTDMKGGLMALVVSLIELKEQNELPHGTIRLLATAGEEKEQEGAKLLADKGYLDDVD
                    ***************::********:**:*******************************

    N315            GLIIAEPTGSGIYYAHKGSMSCKVTATGKAVHSSVPFIGDNAIDTLLEFYNQFKEKYSEL
    NCTC8325        GLIIAEPTGSGIYYAHKGSMSCKVTATGKAVHSSVPFIGDNAIDTLLEFYNLFKEKYSEL
    Newman          GLIIAEPTGSGIYYAHKGSMSCKVTATGKAVHSSVPFIGDNAIDTLLEFYNLFKEKYSEL
    USA300_FPR3757  SLIIAEPTGSGIYYAHKGSMSCKVTATGKAVHSSVPFIGDNAIDTLLEFYNLFKEKYSEL
                    .************************************************** ********

    N315            KKHDTKHELDVAPMFKSLIGKEISEEDANYASGLTAVCSIINGGKQFNSVPDEASLEFNV
    NCTC8325        KQQDTKHELDVAPMFKSLIGKEISEEDANYASGLTAVCSIINGGKQFNSVPDEASLEFNV
    Newman          KQQDTKHELDVAPMFKSLIGKEISEEDANYASGLTAVCSIINGGKQFNSVPDEASLEFNV
    USA300_FPR3757  KQQDTKHELDVAPMFKSLIGKEISEEDANYASGLTAVCSIINGGKQFNSVPDEASLEFNV
                    *::*********************************************************

    N315            RPVPEYDNDFIESFFQNIINDVDSNKLSLDIPSNHRPVTSDKNSKLITTIKDVASSYVEQ
    NCTC8325        RPVPEYDNDFIESFFQNIINDVDSNKLSLDIPSNHRPVTSDKNSKLITTIKDVASSYVEQ
    Newman          RPVPEYDNDFIESFFQNIINDVDSNKLSLDIPSNHRPVTSDKNSKLITTIKDVASSYVEQ
    USA300_FPR3757  RPVPEYDNDFIESFFQNIINDVDSNKLSLDIPSNHRPVTSDKNSKLITTIKDVASSYVEQ
                    ************************************************************

    N315            DEIFVSALVGATDASSFLGDNKDNVDLAIFGPGNPLMAHQIDEYIEKDMYLKYIDIFKEA
    NCTC8325        DEIFVSALVGATDASSFLGDNKDNVDLAIFGPGNPLMAHQIDEYIEKDMYLKYIDIFKEA
    Newman          DEIFVSALVGATDASSFLGDNKDNVDLAIFGPGNPLMAHQIDEYIEKDMYLKYIDIFKEA
    USA300_FPR3757  DEIFVSALVGATDASSFLGDNKDNVDLAIFGPGNPLMAHQIDEYIEKDMYLKYIDIFKEA
                    ************************************************************

    N315            SIQYLKEK
    NCTC8325        SIQYLKEK
    Newman          SIQYLKEK
    USA300_FPR3757  SIQYLKEK
                    ********