From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN005203000
  • symbol?: fhuD1
  • description?: ferrichrome-binding protein FhuD

      descriptions from strain specific annotations:

    • ferrichrome-binding protein FhuD
    • iron compound ABC transporter iron compound-binding protein
    • ferric hydroxamate receptor
    • ferrichrome ABC superfamily ATP binding cassette transporter, binding protein
    • ferrichrome ABC transporter
    • ferrichrome-binding protein precursor
    • ferric hydroxamate receptor 1
    • Iron compound ABC transporter, iron compound-binding protein
    • putative ferrichrome-binding protein precursor
  • strand?: -
  • coordinates?: 5367331..5369276
  • synteny block?: BlockID0040340
  • occurrence?: in 38% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_19310 (fhuD1)
    JH1:
    JH9:
    JKD6008:
    SAA6008_02062
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS1928
    Mu3:
    Mu50:
    MW2:
    MW1945
    RF122:
    ST398:
    T0131:
    SAT0131_02146
    TCH60:
    TW20:
    SATW20_20060
    USA300_TCH1516:
    USA300HOU_2017
    VC40:
    SAVC_08985

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKRLIGILLCNLFILTACSASVDKTSNSTKTTDYKIENGETLKVPEKPKRVAVLTGFYVG
    NCTC8325        MKRLIGILLCNLFILTACSASVDKTSNSTKTTDYKIENGETLKVPEKPKRVAVLTGFYVG
    Newman          MKRLIGILLCNLFILTACSASVDKTSNSTKTTDYKIENGETLKVPEKPKRVAVLTGFYVG
    USA300_FPR3757  MKRLIGILLCNLFILTACSASVDKTSNSTKTTDYKIENGETLKVPEKPKRVAVLTGFYVG
                    ************************************************************

    COL             DFIKLGIKPIAVSDITKDSSILKPYLKGVDYIGENDVERVAKAKPDLIVVDAMDKNIKKY
    NCTC8325        DFIKLGIKPIAVSDITKDSSILKPYLKGVDYIGENDVERVAKAKPDLIVVDAMDKNIKKY
    Newman          DFIKLGIKPIAVSDITKDSSILKPYLKGVDYIGENDVERVAKAKPDLIVVDAMDKNIKKY
    USA300_FPR3757  DFIKLGIKPIAVSDITKDSSILKPYLKGVDYIGENDVERVAKAKPDLIVVDAMDKNIKKY
                    ************************************************************

    COL             QKIAPTIPYTYNKYNHKEILKEIGKLTNNEDKAKKWIEEWDDKTRKDKKEIQSKIGQATA
    NCTC8325        QKIAPTIPYTYNKYNHKEILKEIGKLTNNEDKAKKWIEEWDDKTRKDKKEIQSKIGQATA
    Newman          QKIAPTIPYTYNKYNHKEILKEIGKLTNNEDKAKKWIEEWDDKTRKDKKEIQSKIGQATA
    USA300_FPR3757  QKIAPTIPYTYNKYNHKEILKEIGKLTNNEDKAKKWIEEWDDKTRKDKKEIQSKIGQATA
                    ************************************************************

    COL             SVFEPDEKQIYIYNSTWGRGLDIVHDAFGMPMTKQYKDKLQEDKKGYASISKENISKYAG
    NCTC8325        SVFEPDEKQIYIYNSTWGRGLDIVHDAFGMPMTKQYKDKLQEDKKGYASISKENISKYAG
    Newman          SVFEPDEKQIYIYNSTWGRGLDIVHDAFGMPMTKQYKDKLQEDKKGYASISKENISKYAG
    USA300_FPR3757  SVFEPDEKQIYIYNSTWGRGLDIVHDAFGMPMTKQYKDKLQEDKKGYASISKENISKYAG
                    ************************************************************

    COL             DYIFLSKPSYGKFDFEKTHTWQNIEAVKKGHVISYKAEDYWFTDPITLEHLRSKLKKEIL
    NCTC8325        DYIFLSKPSYGKFDFEKTHTWQNIEAVKKGHVISYKAEDYWFTDPITLEHLRSKLKKEIL
    Newman          DYIFLSKPSYGKFDFEKTHTWQNIEAVKKGHVISYKAEDYWFTDPITLEHLRSKLKKEIL
    USA300_FPR3757  DYIFLSKPSYGKFDFEKTHTWQNIEAVKKGHVISYKAEDYWFTDPITLEHLRSKLKKEIL
                    ************************************************************

    COL             NKK
    NCTC8325        NKK
    Newman          NKK
    USA300_FPR3757  NKK
                    ***