From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005205000
  • symbol?: ktrB
  • description?: H(+)-transporting two-sector ATPase

      descriptions from strain specific annotations:

    • H(+)-transporting two-sector ATPase
    • sodium transport family protein
    • Na+-transporting ATP synthase
    • cation transport family protein
    • ktr system potassium uptake protein B
    • cation transport protein
    • Trk family K+ transporter ABC protein
    • putative sodium transport protein
    • Trk family potassium (K+) transporter, ABC protein
    • KtrB
  • strand?: +
  • coordinates?: 5370655..5371962
  • synteny block?: BlockID0040360
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1969
    08BA02176:
    C248_2030
    11819-97:
    MS7_2040 (ktrB)
    71193:
    ST398NM01_2063
    ECT-R 2:
    ECTR2_1879
    ED133:
    SAOV_2046
    ED98:
    SAAV_2075
    HO 5096 0412:
    SAEMRSA15_19320
    JH1:
    SaurJH1_2102
    JH9:
    SaurJH9_2065
    JKD6008:
    SAA6008_02063 (trkG)
    JKD6159:
    SAA6159_01942 (trkG)
    LGA251:
    SARLGA251_18280
    M013:
    M013TW_1980
    MRSA252:
    SAR2111
    MSHR1132:
    SAMSHR1132_18500
    MSSA476:
    SAS1929
    Mu3:
    SAHV_1993
    Mu50:
    SAV2007
    MW2:
    MW1946
    RF122:
    SAB1882
    ST398:
    SAPIG2063
    T0131:
    SAT0131_02148
    TCH60:
    HMPREF0772_11174 (ntpJ)
    TW20:
    SATW20_20070
    USA300_TCH1516:
    USA300HOU_2018
    VC40:
    SAVC_08990

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKVHKPLYFYLMLFFSTTIIGALLLYLPFTGKKPISFLDALFIASSAFTVTGLSPVDIG
    N315            MNKVHKPLYFYLMLFFSTTIIGALLLYLPFTGKKPISFLDALFIASSAFTVTGLSPVDIG
    NCTC8325        MNKVHKPLYFYLMLFFSTTIIGALLLYLPFTGKKPISFLDALFIASSAFTVTGLSPVDIG
    Newman          MNKVHKPLYFYLMLFFSTTIIGALLLYLPFTGKKPISFLDALFIASSAFTVTGLSPVDIG
    USA300_FPR3757  MNKVHKPLYFYLMLFFSTTIIGALLLYLPFTGKKPISFLDALFIASSAFTVTGLSPVDIG
                    ************************************************************

    COL             SQFNILGEIVILLLIQIGGLGIVTVTLLTLVFLNRKISMKNRFLIMVTWNIDEPGGVIKL
    N315            SQFNILGEIVILLLIQIGGLGIVTVTLLTLVFLNRKISMKNRFLIMVTWNIDEPGGVIKL
    NCTC8325        SQFNILGEIVILLLIQIGGLGIVTVTLLTLVFLNRKISMKNRFLIMVTWNIDEPGGVIKL
    Newman          SQFNILGEIVILLLIQIGGLGIVTVTLLTLVFLNRKISMKNRFLIMVTWNIDEPGGVIKL
    USA300_FPR3757  SQFNILGEIVILLLIQIGGLGIVTVTLLTLVFLNRKISMKNRFLIMVTWNIDEPGGVIKL
                    ************************************************************

    COL             IKHLAIYSLVTELIGMICLCLSFIPKFGIGKGLFLSLFTSVSAFNNAGFALFKNNLIDYS
    N315            IKHLAIYSLVTELIGMICLCLSFIPKFGIGKGLFLSLFTSVSAFNNAGFALFKNNLIDYS
    NCTC8325        IKHLAIYSLVTELIGMICLCLSFIPKFGIGKGLFLSLFTSVSAFNNAGFALFKNNLIDYS
    Newman          IKHLAIYSLVTELIGMICLCLSFIPKFGIGKGLFLSLFTSVSAFNNAGFALFKNNLIDYS
    USA300_FPR3757  IKHLAIYSLVTELIGMICLCLSFIPKFGIGKGLFLSLFTSVSAFNNAGFALFKNNLIDYS
                    ************************************************************

    COL             SDPIVIITISILIIFGGIGHFVVIDFINCKKLSKLSLHSKLVLTTTSILIIIGAITFFLL
    N315            SDPIVIITISILIIFGGIGHFVVIDFINCKKLSKLSLHSKLVLTTTSILIIIGAITFFLL
    NCTC8325        SDPIVIITISILIIFGGIGHFVVIDFINCKKLSKLSLHSKLVLTTTSILIIIGAITFFLL
    Newman          SDPIVIITISILIIFGGIGHFVVIDFINCKKLSKLSLHSKLVLTTTSILIIIGAITFFLL
    USA300_FPR3757  SDPIVIITISILIIFGGIGHFVVIDFINCKKLSKLSLHSKLVLTTTSILIIIGAITFFLL
                    ************************************************************

    COL             EQFNTMQHMGLVEKIGNSFFQSVTTRTAGFNSIDIASINKSTALMLMLLMFIGGAPLSAA
    N315            EQFNTMQHMGLVEKIGNSFFQSVTTRTAGFNSIDIASINKSTALMLMLLMFIGGAPLSAA
    NCTC8325        EQFNTMQHMGLVEKIGNSFFQSVTTRTAGFNSIDIASINKSTALMLMLLMFIGGAPLSAA
    Newman          EQFNTMQHMGLVEKIGNSFFQSVTTRTAGFNSIDIASINKSTALMLMLLMFIGGAPLSAA
    USA300_FPR3757  EQFNTMQHMGLVEKIGNSFFQSVTTRTAGFNSIDIASINKSTALMLMLLMFIGGAPLSAA
                    ************************************************************

    COL             GGIKITTFAVAFIFVLNYIRKENNVSVFNKEISDKHIKLSIVTINISFLFISIITFILSI
    N315            GGIKITTFAVAFIFVLNYIRKENNVSVFNKEISDKHIKLSIVTINISFLFISIITFILSI
    NCTC8325        GGIKITTFAVAFIFVLNYIRKENNVSVFNKEISDKHIKLSIVTINISFLFISIITFILSI
    Newman          GGIKITTFAVAFIFVLNYIRKENNVSVFNKEISDKHIKLSIVTINISFLFISIITFILSI
    USA300_FPR3757  GGIKITTFAVAFIFVLNYIRKENNVSVFNKEISDKHIKLSIVTINISFLFISIITFILSI
                    ************************************************************

    COL             INPNISLIKLLFEVVSAFGTVGLSMNLTTEYHGITKIIIIFVMLCGKVGLLTLLRTFIPP
    N315            INPNISLIKLLFEVVSAFGTVGLSMNLTTEYHGITKIIIIFVMLCGKVGLLTLLRTFIPP
    NCTC8325        INPNISLIKLLFEVVSAFGTVGLSMNLTTEYHGITKIIIIFVMLCGKVGLLTLLRTFIPP
    Newman          INPNISLIKLLFEVVSAFGTVGLSMNLTTEYHGITKIIIIFVMLCGKVGLLTLLRTFIPP
    USA300_FPR3757  INPNISLIKLLFEVVSAFGTVGLSMNLTTEYHGITKIIIIFVMLCGKVGLLTLLRTFIPP
                    ************************************************************

    COL             KSPKNYRYTKGQIYL
    N315            KSPKNYRYTKGQIYL
    NCTC8325        KSPKNYRYTKGQIYL
    Newman          KSPKNYRYTKGQIYL
    USA300_FPR3757  KSPKNYRYTKGQIYL
                    ***************