From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005266000
  • symbol?: groES
  • description?: co-chaperonin GroES

      descriptions from strain specific annotations:

    • co-chaperonin GroES
    • co-chaperone GroES
    • 10 kDa chaperonin (Protein Cpn10) (groES protein)
    • 10 kDa chaperonin GroES
    • 10 kDa heat shock chaperonin protein
    • chaperonin GroS
    • Heat shock protein 60 family co-chaperone GroES
  • strand?: -
  • coordinates?: 5437227..5437511
  • synteny block?: BlockID0040670
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2017 (groES)
    N315:
    SA1837 (groES)
    NCTC8325:
    SAOUHSC_02255 (groES)
    Newman:
    NWMN_1938 (groES)
    USA300_FPR3757:
    SAUSA300_1983 (groES)
    04-02981:
    SA2981_1971 (groES)
    08BA02176:
    C248_2033 (groES)
    11819-97:
    MS7_2042 (groS)
    71193:
    ST398NM01_2067
    ECT-R 2:
    ECTR2_1881
    ED133:
    SAOV_2067c (groES)
    ED98:
    SAAV_2077 (groES)
    HO 5096 0412:
    SAEMRSA15_19380 (groES)
    JH1:
    SaurJH1_2104 (groES)
    JH9:
    SaurJH9_2067 (groES)
    JKD6008:
    SAA6008_02068 (groES)
    JKD6159:
    SAA6159_01944 (groES)
    LGA251:
    SARLGA251_18320 (groES)
    M013:
    M013TW_1982
    MRSA252:
    SAR2117 (groES)
    MSHR1132:
    SAMSHR1132_18520
    MSSA476:
    SAS1936 (groES)
    Mu3:
    SAHV_2015 (groES)
    Mu50:
    SAV2030 (groES)
    MW2:
    MW1954 (groES)
    RF122:
    SAB1914c (groES)
    ST398:
    SAPIG2067 (groS)
    T0131:
    SAT0131_02176 (dltD)
    TCH60:
    HMPREF0772_11168 (groES)
    TW20:
    SATW20_20130 (groES)
    USA300_TCH1516:
    USA300HOU_2025 (groES)
    VC40:
    SAVC_09030 (groES)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLKPIGNRVIIEKKEQEQTTKSGIVLTDSAKEKSNEGVIVAVGTGRLLNDGTRVTPEVKE
    N315            MLKPIGNRVIIEKKEQEQTTKSGIVLTDSAKEKSNEGVIVAVGTGRLLNDGTRVTPEVKE
    NCTC8325        MLKPIGNRVIIEKKEQEQTTKSGIVLTDSAKEKSNEGVIVAVGTGRLLNDGTRVTPEVKE
    Newman          MLKPIGNRVIIEKKEQEQTTKSGIVLTDSAKEKSNEGVIVAVGTGRLLNDGTRVTPEVKE
    USA300_FPR3757  MLKPIGNRVIIEKKEQEQTTKSGIVLTDSAKEKSNEGVIVAVGTGRLLNDGTRVTPEVKE
                    ************************************************************

    COL             GDRVVFQQYAGTEVKRDNETYLVLNEEDILAVIE
    N315            GDRVVFQQYAGTEVKRDNETYLVLNEEDILAVIE
    NCTC8325        GDRVVFQQYAGTEVKRDNETYLVLNEEDILAVIE
    Newman          GDRVVFQQYAGTEVKRDNETYLVLNEEDILAVIE
    USA300_FPR3757  GDRVVFQQYAGTEVKRDNETYLVLNEEDILAVIE
                    **********************************