From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005267000
  • symbol?:
  • description?: CAAX amino terminal protease family protein

      descriptions from strain specific annotations:

    • CAAX amino terminal protease family protein
    • CAAX amino terminal protease self- immunity family protein
    • abortive infection protein
    • caAX amino terminal protease
    • putative metal-dependent membrane protease
    • membrane protein
  • strand?: +
  • coordinates?: 5437673..5438431
  • synteny block?: BlockID0040680
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1972
    08BA02176:
    C248_2034
    11819-97:
    MS7_2043
    71193:
    ST398NM01_2068
    ECT-R 2:
    ECTR2_1882
    ED133:
    SAOV_2068
    ED98:
    SAAV_2078
    HO 5096 0412:
    SAEMRSA15_19390
    JH1:
    SaurJH1_2105
    JH9:
    SaurJH9_2068
    JKD6008:
    SAA6008_02069
    JKD6159:
    SAA6159_01945
    LGA251:
    SARLGA251_18330
    M013:
    M013TW_1983
    MRSA252:
    SAR2118
    MSHR1132:
    SAMSHR1132_18530
    MSSA476:
    SAS1937
    Mu3:
    SAHV_2016
    Mu50:
    SAV2031
    MW2:
    MW1955
    RF122:
    SAB1915
    ST398:
    SAPIG2068
    T0131:
    SAT0131_02177 (copA)
    TCH60:
    HMPREF0772_11167
    TW20:
    SATW20_20140
    USA300_TCH1516:
    USA300HOU_2026
    VC40:
    SAVC_09035

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTRLWASLLTVIIYILSQFLPLLIVKKLPFVQYSGIELTKAVIYIQLVLFLIAATTIILI
    N315            MTRLWASLLTVIIYILSQFLPLLIVKKLPFVQYSGIELTKAVIYIQLVLFLIAATTIILI
    NCTC8325        MTRLWASLLTVIIYILSQFLPLLIVKKLPFVQYSGIELTKAVIYIQLVLFLIAATTIILI
    Newman          MTRLWASLLTVIIYILSQFLPLLIVKKLPFVQYSGIELTKAVIYIQLVLFLIAATTIILI
    USA300_FPR3757  MTRLWASLLTVIIYILSQFLPLLIVKKLPFVQYSGIELTKAVIYIQLVLFLIAATTIILI
                    ************************************************************

    COL             NLKIKNPTKLELEVKEPKKYIIPWALLGFALVMIYQMVVSIVLTQIYGGQQVSPNTEKLI
    N315            NLKIKNPTKLELEVKEPKKYIIPWALLGFALVMIYQMVVSIVLTQIYGGQQVSPNTEKLI
    NCTC8325        NLKIKNPTKLELEVKEPKKYIIPWALLGFALVMIYQMVVSIVLTQIYGGQQVSPNTEKLI
    Newman          NLKIKNPTKLELEVKEPKKYIIPWALLGFALVMIYQMVVSIVLTQIYGGQQVSPNTEKLI
    USA300_FPR3757  NLKIKNPTKLELEVKEPKKYIIPWALLGFALVMIYQMVVSIVLTQIYGGQQVSPNTEKLI
                    ************************************************************

    COL             IIARKIPIFIFFVSIIGPLLEEYVFRKVIFGELFNAIKGNRIVAFIIATTVSSLIFALAH
    N315            IIARKIPIFIFFVSIIGPLLEEYVFRKVIFGELFNAIKGNRIVAFIIATTVSSLIFALAH
    NCTC8325        IIARKIPIFIFFVSIIGPLLEEYVFRKVIFGELFNAIKGNRIVAFIIATTVSSLIFALAH
    Newman          IIARKIPIFIFFVSIIGPLLEEYVFRKVIFGELFNAIKGNRIVAFIIATTVSSLIFALAH
    USA300_FPR3757  IIARKIPIFIFFVSIIGPLLEEYVFRKVIFGELFNAIKGNRIVAFIIATTVSSLIFALAH
                    ************************************************************

    COL             NDFKFIPVYFGMGVIFSLAYVWTKRLAVPIIIHMLQNGFVVIFQLLNPEALKKATEQANF
    N315            NDFKFIPVYFGMGVIFSLAYVWTKRLAVPIIIHMLQNGFVVIFQLLNPEALKKATEQANF
    NCTC8325        NDFKFIPVYFGMGVIFSLAYVWTKRLAVPIIIHMLQNGFVVIFQLLNPEALKKATEQANF
    Newman          NDFKFIPVYFGMGVIFSLAYVWTKRLAVPIIIHMLQNGFVVIFQLLNPEALKKATEQANF
    USA300_FPR3757  NDFKFIPVYFGMGVIFSLAYVWTKRLAVPIIIHMLQNGFVVIFQLLNPEALKKATEQANF
                    ************************************************************

    COL             IYHIFIP
    N315            IYHIFIP
    NCTC8325        IYHIFIP
    Newman          IYHIFIP
    USA300_FPR3757  IYHIFIP
                    *******