From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005269000
  • symbol?:
  • description?: Nitroreductase family protein
  • strand?: +
  • coordinates?: 5439975..5440607
  • synteny block?: BlockID0040700
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1974
    08BA02176:
    C248_2036
    11819-97:
    MS7_2045
    71193:
    ST398NM01_2070
    ECT-R 2:
    ECTR2_1884
    ED133:
    SAOV_2070
    ED98:
    SAAV_2080
    HO 5096 0412:
    SAEMRSA15_19410
    JH1:
    SaurJH1_2107
    JH9:
    SaurJH9_2070
    JKD6008:
    SAA6008_02071
    JKD6159:
    SAA6159_01947
    LGA251:
    SARLGA251_18350
    M013:
    M013TW_1985
    MRSA252:
    SAR2120
    MSHR1132:
    SAMSHR1132_18550
    MSSA476:
    SAS1939
    Mu3:
    SAHV_2018
    Mu50:
    SAV2033
    MW2:
    MW1957
    RF122:
    SAB1917
    ST398:
    SAPIG2070
    T0131:
    SAT0131_02180
    TCH60:
    HMPREF0772_11165
    TW20:
    SATW20_20160
    USA300_TCH1516:
    USA300HOU_2028
    VC40:
    SAVC_09045

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGLFKKDKKAMTFDNAMEERRSIYNLKDSISISDDELESMIAHAVKHVPSSFNSQSTRIV
    N315            MGLFKKDKKAMTFDNAMEERRSIYNLKDSISISDDELESMIAHAVKHVPSSFNSQSTRIV
    NCTC8325        MGLFKKDKKAMTFDNAMEERRSIYNLKDSISISDDELESMIAHAVKHVPSSFNSQSTRIV
    Newman          MGLFKKDKKAMTFDNAMEERRSIYNLKDSISISDDELESMIAHAVKHVPSSFNSQSTRIV
    USA300_FPR3757  MGLFKKDKKAMTFDNAMEERRSIYNLKDSISISDDELESMIAHAVKHVPSSFNSQSTRIV
                    ************************************************************

    COL             LLLNDNNNKFWDNTKAILKEVMGENRDFEPTEQKIDNFKHSYGTILFYEDQDVVSGLQEQ
    N315            LLLNDNNNKFWDNTKAILKEVMGENRDFEPTEQKIDNFKHSYGTILFYEDQDVVSGLQEQ
    NCTC8325        LLLNDNNNKFWDNTKAILKEVMGENRDFEPTEQKIDNFKHSYGTILFYEDQDVVSGLQEQ
    Newman          LLLNDNNNKFWDNTKAILKEVMGENRDFEPTEQKIDNFKHSYGTILFYEDQDVVSGLQEQ
    USA300_FPR3757  LLLNDNNNKFWDNTKAILKEVMGENRDFEPTEQKIDNFKHSYGTILFYEDQDVVSGLQEQ
                    ************************************************************

    COL             MPNYYDNFAIWSTQTNAMHQFAIWTALATKGIGASLQHYNPLVDEMTSNEFNIPKSWKLI
    N315            MPNYYDNFAIWSTQTNAMHQFAIWTALATKGIGASLQHYNPLVDEMTSKEFNIPKSWKLI
    NCTC8325        MPNYYDNFAIWSTQTNAMHQFAIWTALATKGIGASLQHYNPLVDEMTSNEFNIPKSWKLI
    Newman          MPNYYDNFAIWSTQTNAMHQFAIWTALATKGIGASLQHYNPLVDEMTSNEFNIPKSWKLI
    USA300_FPR3757  MPNYYDNFAIWSTQTNAMHQFAIWTALATKGIGASLQHYNPLVDEMTSNEFNIPKSWKLI
                    ************************************************:***********

    COL             AQMPFGDIREAAGEKTFNPVEDRFVIKK
    N315            AQMPFGDIREAAGEKTFNPVEDRFVIKK
    NCTC8325        AQMPFGDIREAAGEKTFNPVEDRFVIKK
    Newman          AQMPFGDIREAAGEKTFNPVEDRFVIKK
    USA300_FPR3757  AQMPFGDIREAAGEKTFNPVEDRFVIKK
                    ****************************