From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005283000
  • symbol?:
  • description?: ribokinase-like domain-containing protein

      descriptions from strain specific annotations:

    • ribokinase-like domain-containing protein
    • fructokinase, putative
    • Fructokinase
    • pfkB family carbohydrate kinase family protein
    • fructokinase-1
    • PfkB family kinase
    • PfkB domain-containing protein
    • putative fructokinase
    • fructokinase-2
  • strand?: -
  • coordinates?: 5447782..5448741
  • synteny block?: BlockID0040830
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1981
    08BA02176:
    C248_2044
    11819-97:
    MS7_2051 (frk1)
    71193:
    ST398NM01_2077
    ECT-R 2:
    ECTR2_1891
    ED133:
    SAOV_2077c
    ED98:
    SAAV_2088
    HO 5096 0412:
    SAEMRSA15_19480
    JH1:
    SaurJH1_2113
    JH9:
    SaurJH9_2077
    JKD6008:
    SAA6008_02078
    JKD6159:
    SAA6159_01953
    LGA251:
    SARLGA251_18420
    M013:
    M013TW_1992
    MRSA252:
    SAR2127
    MSHR1132:
    SAMSHR1132_18620
    MSSA476:
    SAS1945
    Mu3:
    SAHV_2025
    Mu50:
    SAV2040
    MW2:
    MW1964
    RF122:
    SAB1924c
    ST398:
    SAPIG2077
    T0131:
    SAT0131_02190
    TCH60:
    HMPREF0772_11159 (frk)
    TW20:
    SATW20_20230
    USA300_TCH1516:
    USA300HOU_2037 (frk)
    VC40:
    SAVC_09080

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRRLFSIGEALIDFIPNVTNANLKDVQTFTKQIGGAPCNVACTVQKLGQQAYMITQLGND
    N315            MRRLFSIGEALIDFIPNVTNANLKDVQTFTKQIGGAPCNVACTVQKLGQQAYMITQLGND
    NCTC8325        MRRLFSIGEALIDFIPNVTNANLKDVQTFTKQIGGAPCNVACTVQKLGQQAYMITQLGND
    Newman          MRRLFSIGEALIDFIPNVTNANLKDVQTFTKQIGGAPCNVACTVQKLGQQAYMITQLGND
    USA300_FPR3757  MRRLFSIGEALIDFIPNVTNANLKDVQTFTKQIGGAPCNVACTVQKLGQQAYMITQLGND
                    ************************************************************

    COL             AFGDSIIETISSIGVDVSKVYRTNEANTALAFVSLTEAGERDFSFYRKPSADMLFEPSFV
    N315            AFGDSIIETISSIGVDVSKVYRTNEANTALAFVSLTEAGERDFSFYRKPSADMLFEPSFV
    NCTC8325        AFGDSIIETISSIGVDVSKVYRTNEANTALAFVSLTEAGERDFSFYRKPSADMLFEPSFV
    Newman          AFGDSIIETISSIGVDVSKVYRTNEANTALAFVSLTEAGERDFSFYRKPSADMLFEPSFV
    USA300_FPR3757  AFGDSIIETISSIGVDVSKVYRTNEANTALAFVSLTEAGERDFSFYRKPSADMLFEPSFV
                    ************************************************************

    COL             NDIDVNENDVVHFCSVDLVDSPMRDAHYQLITKTLNANGTVVFDPNVRLPLWDNAEDLRQ
    N315            NDIDVNENDVVHFCSVDLVDSPMRDAHYQLITKTLNANGTVVFDPNVRLPLWDNAEDLRQ
    NCTC8325        NDIDVNENDVVHFCSVDLVDSPMRDAHYQLITKTLNANGTVVFDPNVRLPLWDNAEDLRQ
    Newman          NDIDVNENDVVHFCSVDLVDSPMRDAHYQLITKTLNANGTVVFDPNVRLPLWDNAEDLRQ
    USA300_FPR3757  NDIDVNENDVVHFCSVDLVDSPMRDAHYQLITKTLNANGTVVFDPNVRLPLWDNAEDLRQ
                    ************************************************************

    COL             TIHTFLPLAHIVKVSDEELEFITGIHDENEAIQSLFTGNVTVVIYTKGADGAAVYLKNGI
    N315            TIHTFLPLAHIVKVSDEELEFITGIHDENEAIQSLFTGNVTVVIYTKGADGAAVYLKNGI
    NCTC8325        TIHTFLPLAHIVKVSDEELEFITGIHDENEAIQSLFTGNVTVVIYTKGADGAAVYLKNGI
    Newman          TIHTFLPLAHIVKVSDEELEFITGIHDENEAIQSLFTGNVTVVIYTKGADGAAVYLKNGI
    USA300_FPR3757  TIHTFLPLAHIVKVSDEELEFITGIHDENEAIQSLFTGNVTVVIYTKGADGAAVYLKNGI
                    ************************************************************

    COL             NHYHSGYKVKPVDTTGAGDAFIGAVISRILATDVLNLTQLFENEGEEILAFSNRVAAIVT
    N315            NHYHSGYKVKPVDTTGAGDAFIGAVISRILATDVLNLTQLFENEGEEILAFSNRVAAIVT
    NCTC8325        NHYHSGYKVKPVDTTGAGDAFIGAVISRILATDVLNLTQLFENEGEEILAFSNRVAAIVT
    Newman          NHYHSGYKVKPVDTTGAGDAFIGAVISRILATDVLNLTQLFENEGEEILAFSNRVAAIVT
    USA300_FPR3757  NHYHSGYKVKPVDTTGAGDAFIGAVISRILATDVLNLTQLFENEGEEILAFSNRVAAIVT
                    ************************************************************

    COL             TKYGAINSLPTLQEVEQAF
    N315            TKYGAINSLPTLQEVEQAF
    NCTC8325        TKYGAINSLPTLQEVEQAF
    Newman          TKYGAINSLPTLQEVEQAF
    USA300_FPR3757  TKYGAINSLPTLQEVEQAF
                    *******************