From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005289000
  • symbol?:
  • description?: sirA-like family protein

      descriptions from strain specific annotations:

    • sirA-like family protein
    • putative transcriptional regulator
    • Transcription regulator
  • strand?: -
  • coordinates?: 5452982..5453179
  • synteny block?: BlockID0040890
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1985
    08BA02176:
    C248_2048
    11819-97:
    MS7_2055
    71193:
    ST398NM01_2082
    ECT-R 2:
    ECTR2_1895
    ED133:
    SAOV_2081c
    ED98:
    SAAV_2092
    HO 5096 0412:
    SAEMRSA15_19520
    JH1:
    SaurJH1_2118
    JH9:
    SaurJH9_2081
    JKD6008:
    SAA6008_02082
    JKD6159:
    SAA6159_01957
    LGA251:
    SARLGA251_18460
    M013:
    M013TW_1996
    MRSA252:
    SAR2131
    MSHR1132:
    SAMSHR1132_18660
    MSSA476:
    SAS1949
    Mu3:
    SAHV_2029
    Mu50:
    SAV2044
    MW2:
    MW1968
    RF122:
    SAB1928c
    ST398:
    SAPIG2082
    T0131:
    SAT0131_02194 (tnp)
    TCH60:
    HMPREF0772_11155
    TW20:
    SATW20_20270
    USA300_TCH1516:
    USA300HOU_2041
    VC40:
    SAVC_09100

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIHELGTVGMVCPFPLIEAQKKMATLQSGDELKIDFDCTQATEAIPNWAAENGYPVTNYE
    N315            MIHELGTVGMVCPFPLIEAQKKMATLQSGDELKIDFDCTQATEAIPNWAAENGYPITNYE
    NCTC8325        MIHELGTVGMVCPFPLIEAQKKMATLQSGDELKIDFDCTQATEAIPNWAAENGYPVTNYE
    Newman          MIHELGTVGMVCPFPLIEAQKKMATLQSGDELKIDFDCTQATEAIPNWAAENGYPVTNYE
    USA300_FPR3757  MIHELGTVGMVCPFPLIEAQKKMATLQSGDELKIDFDCTQATEAIPNWAAENGYPVTNYE
                    *******************************************************:****

    COL             QIDNASWTITIQKV
    N315            QIDNASWTITIQKV
    NCTC8325        QIDNASWTITIQKV
    Newman          QIDNASWTITIQKV
    USA300_FPR3757  QIDNASWTITIQKV
                    **************