From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005335000
  • symbol?: rsbV
  • description?: anti-sigmaB factor antagonist

      descriptions from strain specific annotations:

    • anti-sigmaB factor antagonist
    • anti-anti-sigma factor RsbV
    • anti-sigma-B factor, antagonist
    • STAS domain-containing protein
    • anti-sigma-factor antagonist
    • anti-sigma F factor antagonist
    • anti-sigma-B factor antagonist (Anti-anti-sigma-B factor)
    • anti-sigma F factor antagonist (spoIIAA-2)
    • anti sigma b factor antagonist RsbV
  • strand?: -
  • coordinates?: 5513223..5513549
  • synteny block?: BlockID0041320
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2056 (rsbV)
    N315:
    SA1871 (rsbV)
    NCTC8325:
    Newman:
    NWMN_1972 (rsbV)
    USA300_FPR3757:
    04-02981:
    SA2981_2007 (rsbV)
    08BA02176:
    C248_2077 (rsbV)
    11819-97:
    MS7_2083 (rsbV)
    71193:
    ST398NM01_2107
    ECT-R 2:
    ECTR2_1922
    ED133:
    SAOV_2108c (rsbV)
    ED98:
    SAAV_2119 (rsbV)
    HO 5096 0412:
    SAEMRSA15_19760 (rsbV)
    JH1:
    SaurJH1_2140
    JH9:
    SaurJH9_2103
    JKD6008:
    SAA6008_02105 (rsbV)
    JKD6159:
    SAA6159_01981 (rsbV)
    LGA251:
    SARLGA251_18690 (rsbV)
    M013:
    M013TW_2025
    MRSA252:
    SAR2154 (rsbV)
    MSHR1132:
    SAMSHR1132_18910
    MSSA476:
    SAS1971
    Mu3:
    SAHV_2051 (rsbV)
    Mu50:
    SAV2066 (rsbV)
    MW2:
    MW1990 (rsbV)
    RF122:
    SAB1951c (rsbV)
    ST398:
    SAPIG2107
    T0131:
    SAT0131_02223
    TCH60:
    HMPREF0772_11129 (rsbV)
    TW20:
    SATW20_22060 (rsbV)
    USA300_TCH1516:
    USA300HOU_2061 (rsbV)
    VC40:
    SAVC_09210

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNLNIETTTQDKFYEVKVGGELDVYTVPELEEVLTPMRQDGTRDIYVNLENVSYMDSTGL
    N315            MNLNIETTTQDKFYEVKVGGELDVYTVPELEEVLTPMRQDGTRDIYVNLENVSYMDSTGL
    NCTC8325        MNLNIETTTQDKFYEVKVGGELDVYTVPELEEVLTPMRQDGTRDIYVNLENVSYMDSTGL
    Newman          MNLNIETTTQDKFYEVKVGGELDVYTVPELEEVLTPMRQDGTRDIYVNLENVSYMDSTGL
    USA300_FPR3757  MNLNIETTTQDKFYEVKVGGELDVYTVPELEEVLTPMRQDGTRDIYVNLENVSYMDSTGL
                    ************************************************************

    COL             GLFVGTLKALNQNDKELYILGVSDRIGRLFEITGLKDLMHVNEGTEVE
    N315            GLFVGTLKALNQNDKELYILGVSDRIGRLFEITGLKDLMHVNEGTEVE
    NCTC8325        GLFVGTLKALNQNDKELYILGVSDRIGRLFEITGLKDLMHVNEGTEVE
    Newman          GLFVGTLKALNQNDKELYILGVSDRIGRLFEITGLKDLMHVNEGTEVE
    USA300_FPR3757  GLFVGTLKALNQNDKELYILGVSDRIGRLFEITGLKDLMHVNEGTEVE
                    ************************************************