From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005336000
  • symbol?: rsbU
  • description?: serine phosphatase

      descriptions from strain specific annotations:

    • serine phosphatase
    • sigma factor B regulator protein
    • sigmaB regulation protein RsbU
    • sigma factor sigB regulation protein
    • sigma-B regulation protein
    • phosphoserine phosphatase rsbU (Sigma factor sigBregulation protein rsbU)
    • indirect positive regulator of sigma B
    • putative sigma factor sigB regulation protein
    • Serine phosphatase RsbU, regulator of sigma subunit
    • sigma factor B regulation protein
    • stage II sporulation E family protein
  • strand?: -
  • coordinates?: 5513670..5514469
  • synteny block?: BlockID0041330
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2057 (rsbU)
    N315:
    SA1872 (rsbU)
    NCTC8325:
    Newman:
    NWMN_1973 (rsbU)
    USA300_FPR3757:
    04-02981:
    SA2981_2008 (rsbU)
    08BA02176:
    C248_2078 (rsbU)
    11819-97:
    MS7_2084 (rsbU)
    71193:
    ST398NM01_2108
    ECT-R 2:
    ECTR2_1923
    ED133:
    SAOV_2109c
    ED98:
    SAAV_2120 (rsbU)
    HO 5096 0412:
    SAEMRSA15_19770 (rsbU)
    JH1:
    SaurJH1_2141
    JH9:
    SaurJH9_2104
    JKD6008:
    SAA6008_02106 (rsbU)
    JKD6159:
    SAA6159_01982 (rsbU)
    LGA251:
    SARLGA251_18700 (rsbU)
    M013:
    M013TW_2026
    MRSA252:
    SAR2155 (rsbU)
    MSHR1132:
    SAMSHR1132_18920
    MSSA476:
    SAS1972
    Mu3:
    SAHV_2052 (rsbU)
    Mu50:
    SAV2067 (rsbU)
    MW2:
    MW1991 (rsbU)
    RF122:
    SAB1952c (rsbU)
    ST398:
    SAPIG2108
    T0131:
    SAT0131_02224
    TCH60:
    HMPREF0772_11128 (rsbU)
    TW20:
    SATW20_22070 (rsbU)
    USA300_TCH1516:
    USA300HOU_2062 (rsbU)
    VC40:
    SAVC_09215

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEEFKQHYKGLIDESLTCQDKVELIKKCEKYTDEVIRKDVLPEDIVDIHKNYILTLNLTR
    N315            MEEFKQHYKGLIDESLTCQDKVELIKKCEKYTDEVIRKDVLPEDIVDIHKNYILTLNLTR
    Newman          MEEFKQHYKGLIDESLTCQDKVELIKKCEKYTDEVIRKDVLPEDIVDIHKNYILTLNLTR
    USA300_FPR3757  MEEFKQHYKGLIDESLTCQDKVELIKKCEKYTDEVIRKDVLPEDIVDIHKNYILTLNLTR
                    ************************************************************

    COL             EDVFKTLDVLQEIVKGFGYSYRDYQRLVDKLQVHDKEIDLASSLQQTMLKTDIPQFDSIQ
    N315            EDVFKTLDVLQEIVKGFGYSYRDYQRLVDKLQVHDKEIDLASSLQQTMLKTDIPQFDSIQ
    Newman          EDVFKTLDVLQEIVKGFGYSYRDYQRLVDKLQVHDKEIDLASSLQQTMLKTDIPQFDSIQ
    USA300_FPR3757  EDVFKTLDVLQEIVKGFGYSYRDYQRLVDKLQVHDKEIDLASSLQQTMLKTDIPQFDSIQ
                    ************************************************************

    COL             IGVISVAAQKVSGDYFNLIDHNDGTMSFAVADVIGKGIPAALAMSMIKFGMDSYGHSQLP
    N315            IGVISVAAQKVSGDYFNLIDHNDGTMSFAVADVIGKGIPAALAMSMIKFGMDSYGHSQLP
    Newman          IGVISVAAQKVSGDYFNLIDHNDGTMSFAVADVIGKGIPAALAMSMIKFGMDSYGHSQLP
    USA300_FPR3757  IGVISVAAQKVSGDYFNLIDHNDGTMSFAVADVIGKGIPAALAMSMIKFGMDSYGHSQLP
                    ************************************************************

    COL             SDGLKRLNRVVEKNINQNMFVTMFYGLYEEMNHLLYCSSAGHEPGYIYRAEKEEFEEISV
    N315            SDGLKRLNRVVEKNINQNMFVTMFYGLYEEMNHLLYCSSAGHEPGYIYRAEKEEFEEISV
    Newman          SDGLKRLNRVVEKNINQNMFVTMFYGLYEEMNHLLYCSSAGHEPGYIYRAEKEEFEEISV
    USA300_FPR3757  SDGLKRLNRVVEKNINQNMFVTMFYGLYEEMNHLLYCSSAGHEPGYIYRAEKEEFEEISV
                    ************************************************************

    COL             RGRVLGISSQTRYQQQEIPIYLDDLIIILTDGVTEARNSEGTFIDKQKLLEYIKKHKHMH
    N315            RGRVLGISSQTRYQQQEIPIYLDDLIIILTDGVTEARNSEGTFIDKQKLLEYIKKHKHMH
    Newman          RGRVLGISSQTRYQQQEIPIYLDDLIIILTDGVTEARNSEGTFIDKQKLLEYIKKHKHMH
    USA300_FPR3757  RGRVLGISSQTRYQQQEIPIYLDDLIIILTDGVTEARNSEGTFIDKQKLLEYIKKHKHMH
                    ************************************************************

    COL             PQDIVQIIYEAILKLQNPNKKDDMTILIIKRVN
    N315            PQDIVQIIYEAILKLQNPNKKDDMTILIIKRVN
    Newman          PQDIVQIIYEAILKLQNPNKKDDMTILIIKRVN
    USA300_FPR3757  PQDIVQIIYEAILKLQNPNKKDDMTILIIKRVN
                    *********************************