From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005342000
  • symbol?: acpS
  • description?: 4'-phosphopantetheinyl transferase

      descriptions from strain specific annotations:

    • 4'-phosphopantetheinyl transferase
    • holo-ACP synthase
    • Holo-[acyl-carrier protein] synthase
    • holo-(acyl-carrier-protein) synthase
    • holo-[acyl-carrier-protein] synthase (Holo-ACP synthase)(4'-phosphopantetheinyl transferase acpS)
    • holo-acyl-carrier protein synthase
    • Holo- synthase
  • strand?: -
  • coordinates?: 5516855..5517214
  • synteny block?: BlockID0041390
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2061 (acpS)
    N315:
    SA1875 (acpS)
    NCTC8325:
    Newman:
    NWMN_1976 (acpS)
    USA300_FPR3757:
    04-02981:
    SA2981_2012 (dpj)
    08BA02176:
    C248_2083 (acpS)
    11819-97:
    MS7_2088 (acpS)
    71193:
    ST398NM01_2112
    ECT-R 2:
    ECTR2_1927 (acpS)
    ED133:
    SAOV_2113c (acpS)
    ED98:
    SAAV_2124 (acpS)
    HO 5096 0412:
    SAEMRSA15_19810 (acpS)
    JH1:
    SaurJH1_2146 (acpS)
    JH9:
    SaurJH9_2108 (acpS)
    JKD6008:
    SAA6008_02110 (acpS)
    JKD6159:
    SAA6159_01986 (acpS)
    LGA251:
    SARLGA251_18740 (acpS)
    M013:
    M013TW_2030
    MRSA252:
    SAR2159 (acpS)
    MSHR1132:
    SAMSHR1132_18960
    MSSA476:
    SAS1976 (acpS)
    Mu3:
    SAHV_2056 (acpS)
    Mu50:
    SAV2071 (acpS)
    MW2:
    MW1995 (acpS)
    RF122:
    SAB1956c (acpS)
    ST398:
    SAPIG2112 (acpS)
    T0131:
    SAT0131_02228 (gudB)
    TCH60:
    HMPREF0772_11124 (acpS2)
    TW20:
    SATW20_22110 (acpS)
    USA300_TCH1516:
    USA300HOU_2066 (acpS)
    VC40:
    SAVC_09240 (acpS)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIHGIGVDLIEIDRIQALYSKQPKLVERILTKNEQHKFNNFTHEQRKIEFLAGRFATKEA
    N315            MIHGIGVDLIEIDRIKVLYSKQPKLVERILTKNEQHKFNNFTHEQRKIEFLAGRFATKEA
    NCTC8325        MIHGIGVDLIEIDRIQALYSKQPKLVERILTKNEQHKFNNFTHEQRKIEFLAGRFATKEA
    Newman          MIHGIGVDLIEIDRIQALYSKQPKLVERILTKNEQHKFNNFTHEQRKIEFLAGRFATKEA
    USA300_FPR3757  MIHGIGVDLIEIDRIQALYSKQPKLVERILTKNEQHKFNNFTHEQRKIEFLAGRFATKEA
                    ***************:.*******************************************

    COL             FSKALGTGLGKHVAFNDIDCYNDELGKPKIDYEGFIVHVSISHTEHYAMSQVVLEKSAF
    N315            FSKALGTGLGKHVAFNDIDCYNDELGKPKIDYEGFIVHVSISHTEHYAMSQVVLEKSAF
    NCTC8325        FSKALGTGLGKHVAFNDIDCYNDELGKPKIDYEGFIVHVSISHTEHYAMSQVVLEKSAF
    Newman          FSKALGTGLGKHVAFNDIDCYNDELGKPKIDYEGFIVHVSISHTEHYAMSQVVLEKSAF
    USA300_FPR3757  FSKALGTGLGKHVAFNDIDCYNDELGKPKIDYEGFIVHVSISHTEHYAMSQVVLEKSAF
                    ***********************************************************