From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005344000
  • symbol?:
  • description?: membrane flanked domain protein

      descriptions from strain specific annotations:

    • membrane flanked domain protein
    • bacterial membrane flanked domain family
    • membrane-flanked domain-containing protein
    • membrane protein
    • membrane spanning protein
  • strand?: -
  • coordinates?: 5517708..5519291
  • synteny block?: BlockID0041410
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2014 (ydbT)
    08BA02176:
    C248_2085
    11819-97:
    MS7_2090
    71193:
    ST398NM01_2114
    ECT-R 2:
    ECTR2_1929
    ED133:
    SAOV_2115c
    ED98:
    SAAV_2126
    HO 5096 0412:
    SAEMRSA15_19830
    JH1:
    SaurJH1_2148
    JH9:
    SaurJH9_2110
    JKD6008:
    SAA6008_02112
    JKD6159:
    SAA6159_01988
    LGA251:
    SARLGA251_18760
    M013:
    M013TW_2032
    MRSA252:
    SAR2161
    MSHR1132:
    SAMSHR1132_18980
    MSSA476:
    SAS1978
    Mu3:
    SAHV_2058
    Mu50:
    SAV2073
    MW2:
    MW1997
    RF122:
    SAB1958c
    ST398:
    SAPIG2114
    T0131:
    SAT0131_02230
    TCH60:
    HMPREF0772_11122
    TW20:
    SATW20_22130
    USA300_TCH1516:
    USA300HOU_2068
    VC40:
    SAVC_09250

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSEPQKLHPISYFNGIINAIKQNIVVFFIFIIFQLKDFDYTNPESYLWIGIVFVFFLISY
    N315            MSEPQKLHPISYFNGIINAIKQNIVVFFIFIIFQLKDFDYTNPESYLWIGIVFVFFLISY
    NCTC8325        MSEPQKLHPISYFNGIINAIKQNIVVFFIFIIFQLKDFDYTNPESYLWIGIVFVFFLISY
    Newman          MSEPQKLHPISYFNGIINAIKQNIVVFFIFIIFQLKDFDYTNPESYLWIGIVFVFFLISY
    USA300_FPR3757  MSEPQKLHPISYFNGIINAIKQNIVVFFIFIIFQLKDFDYTNPESYLWIGIVFVFFLISY
                    ************************************************************

    COL             ISQIVGIMNTRYWIEDNYFILTTGIFNKKRKELNIKRIQSVDMTQGVVNQIIGGVDLQIK
    N315            ISQIVGIMNTRYWIEDNYFILTTGIFNKKRKELNIKRIQSVDMTQGVVNQIIGGVDLQIK
    NCTC8325        ISQIVGIMNTRYWIEDNYFILTTGIFNKKRKELNIKRIQSVDMTQGVVNQIIGGVDLQIK
    Newman          ISQIVGIMNTRYWIEDNYFILTTGIFNKKRKELNIKRIQSVDMTQGVVNQIIGGVDLQIK
    USA300_FPR3757  ISQIVGIMNTRYWIEDNYFILTTGIFNKKRKELNIKRIQSVDMTQGVVNQIIGGVDLQIK
                    ************************************************************

    COL             TPSDGIVLSVISKKQGEYLERYIDQLQTELKTEVAQKSSAEKNDNCNHDIEGNVEDIAEG
    N315            TPSDGIVLSVISKKQGEYLERYIDQLQTELKTEVAQKSSAEKNDNCNHDIEGNVEDIAEG
    NCTC8325        TPSDGIVLSVISKKQGEYLERYIDQLQTELKTEVAQKSSAEKNDNCNHDIEGNVEDIAEG
    Newman          TPSDGIVLSVISKKQGEYLERYIDQLQTELKTEVAQKSSAEKNDNCNHDIEGNVEDIAEG
    USA300_FPR3757  TPSDGIVLSVISKKQGEYLERYIDQLQTELKTEVAQKSSAEKNDNCNHDIEGNVEDIAEG
                    ************************************************************

    COL             RLDEVQNTDSMLNQKNKRIPIYQMNFKESLFMAMTSGAIGVTLAALVPIYGAVRELIPWS
    N315            RLDEVQNTDSMLNQKNKRIPIYQMNFKESLFMAMTSGAIGVTLAALVPIYGAVRELIPWS
    NCTC8325        RLDEVQNTDSMLNQKNKRIPIYQMNFKESLFMAMTSGAIGVTLAALVPIYGAVRELIPWS
    Newman          RLDEVQNTDSMLNQKNKRIPIYQMNFKESLFMAMTSGAIGVTLAALVPIYGAVRELIPWS
    USA300_FPR3757  RLDEVQNTDSMLNQKNKRIPIYQMNFKESLFMAMTSGAIGVTLAALVPIYGAVRELIPWS
                    ************************************************************

    COL             KLNHEISQWVQIVSISVLIIILLVLIVAYIIGTIITMIRFYGFSVMLENEQLKIEYGLFN
    N315            KLNHEISQWVQIVSISVLIIILLVLIVAYIIGTIITMIRFYGFSVMLENEQLKIEYGLFN
    NCTC8325        KLNHEISQWVQIVSISVLIIILLVLIVAYIIGTIITMIRFYGFSVMLENEQLKIEYGLFN
    Newman          KLNHEISQWVQIVSISVLIIILLVLIVEYIIGTIITMIRFYGFSVMLENEQLKIEYGLFN
    USA300_FPR3757  KLNHEISQWVQIVSISVLIIILLVLIVAYIIGTIITMIRFYGFSVMLENEQLKIEYGLFN
                    *************************** ********************************

    COL             KKKVTVPTKRLQAVVERQSYIRRLFGYTAIHFIITSDFENKKIEDDDNDSGSVPILPFIK
    N315            KKKVTVPTKRLQAVVERQSYIRRLFGYTAIHFIITSDFENKKIEDDDNDSGSVPILPFIK
    NCTC8325        KKKVTVPTKRLQAVVERQSYIRRLFGYTAIHFIITSDFENKKIEDDDNDSGSVPILPFIK
    Newman          KKKVTVPTKRLQAVVERQSYIRRLFGYTAIHFIITSDFENKKIEDDDNDSGSVPILPFIK
    USA300_FPR3757  KKKVTVPTKRLQAVVERQSYIRRLFGYTAIHFIITSDFENKKIEDDDNDSGSVPILPFIK
                    ************************************************************

    COL             RDKAYQIIQNLVPDLSYQQVNEGMPLSGFHRHFLIPSIIVIAMAGIGCYFWNQLLLLFTI
    N315            RDKAYQIIQNLVPDLSYQQVNEGMPLSGFHRHFLIPSIIVIAMAGIGCYFWNQLLLLFTI
    NCTC8325        RDKAYQIIQNLVPDLSYQQVNEGMPLSGFHRHFLIPSIIVIAMAGIGCYFWNQLLLLFTI
    Newman          RDKAYQIIQNLVPDLSYQQVNEGMPLSGFHRHFLIPSIIVIAMAGIGCYFWNQLLLLFTI
    USA300_FPR3757  RDKAYQIIQNLVPDLSYQQVNEGMPLSGFHRHFLIPSIIVIAMAGIGCYFWNQLLLLFTI
                    ************************************************************

    COL             ITIVIIGLFVIKGYLYVKHAGFKMTEEQITIQNFELLKRNIYYFKAHHIIGFDTWQHTLL
    N315            ITIVIIGLFVIKGYLYVKHAGFKMTEEQITIQNFELLKRNIYYFKAHHIIGFDTWQHTLL
    NCTC8325        ITIVIIGLFVIKGYLYVKHAGFKMTEEQITIQNFELLKRNIYYFKAHHIIGFDTWQHTLL
    Newman          ITIVIIGLFVIKGYLYVKHAGFKMTEEQITIQNFELLKRNIYYFKAHHIIGFDTWQHTLL
    USA300_FPR3757  ITIVIIGLFVIKGYLYVKHAGFKMTEEQITIQNFELLKRNIYYFKAHHIIGFDTWQHTLL
                    ************************************************************

    COL             KRNNLNNFSFIVAKGVGAQSINLKYARSEDANKLKSWYLRGENDEGL
    N315            KRNNLNNFSFIVAKGVGAQSINLKYARSEDANKLKSWYLRGENDEGL
    NCTC8325        KRNNLNNFSFIVAKGVGAQSINLKYARSEDANKLKSWYLRGENDEGL
    Newman          KRNNLNNFSFIVAKGVGAQSINLKYARSEDANKLKSWYLRGENDEGL
    USA300_FPR3757  KRNNLNNFSFIVAKGVGAQSINLKYARSEDANKLKSWYLRGENDEGL
                    ***********************************************