From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005345000
  • symbol?:
  • description?: bacterial membrane flanked domain protein

      descriptions from strain specific annotations:

    • bacterial membrane flanked domain protein
    • membrane protein
  • strand?: -
  • coordinates?: 5519284..5519763
  • synteny block?: BlockID0041420
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2015
    08BA02176:
    C248_2086
    11819-97:
    MS7_2091
    71193:
    ST398NM01_2115
    ECT-R 2:
    ECTR2_1930
    ED133:
    SAOV_2116c
    ED98:
    SAAV_2127
    HO 5096 0412:
    SAEMRSA15_19840
    JH1:
    SaurJH1_2149
    JH9:
    SaurJH9_2111
    JKD6008:
    SAA6008_02113
    JKD6159:
    SAA6159_01989
    LGA251:
    SARLGA251_18770
    M013:
    M013TW_2033
    MRSA252:
    SAR2162
    MSHR1132:
    SAMSHR1132_18990
    MSSA476:
    SAS1979
    Mu3:
    SAHV_2059
    Mu50:
    SAV2074
    MW2:
    MW1998
    RF122:
    SAB1959c
    ST398:
    SAPIG2115
    T0131:
    SAT0131_02231 (argH)
    TCH60:
    HMPREF0772_11121
    TW20:
    SATW20_22140
    USA300_TCH1516:
    USA300HOU_2069
    VC40:
    SAVC_09255

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSDYTKLTKSPKSALLYYYITNGLEFILSVAVYVIFYFIWLRFEWPHYLLYILLVLGALS
    N315            MSDYTKLTKSPKSALLYYYITNGLEFILSVAVYVIFYFIWLRFEWPHYLLYILLVLGALS
    NCTC8325        MSDYTKLTKSPKSALLYYYITNGLEFILSVAVYVIFYFIWLRFEWPHYLLYILLVLGALS
    Newman          MSDYTKLTKSPKSALLYYYITNGLEFILSVAVYVIFYFIWLRFEWPHYLLYILLVLGALS
    USA300_FPR3757  MSDYTKLTKSPKSALLYYYITNGLEFILSVAVYVIFYFIWLRFEWPHYLLYILLVLGALS
                    ************************************************************

    COL             TLKLFIKPLWQYHCRFYKVDQLSVQYRTSFFIYKEETSRIERLQYLSIKSNPISKVLNLY
    N315            TLKLFIKPLWQYHCRFYKVDQLSVQYRTSFFIYKEETSRIERLQYLSIKSNPISKVLNLY
    NCTC8325        TLKLFIKPLWQYHCRFYKVDQLSVQYRTSFFIYKEETSRIERLQYLSIKSNPISKVLNLY
    Newman          TLKLFIKPLWQYHCRFYKVDQLSVQYRTSFFIYKEETSRIERLQYLSIKSNPISKVLNLY
    USA300_FPR3757  TLKLFIKPLWQYHCRFYKVDQLSVQYRTSFFIYKEETSRIERLQYLSIKSNPISKVLNLY
                    ************************************************************

    COL             KVGFMTAGHTIYLPMMSHDDVKIIEERTMSNLRGVESDV
    N315            KVGFMTAGHTIYLPMMSHDDVKIIEARTMSNLRGVESDV
    NCTC8325        KVGFMTAGHTIYLPMMSHDDVKIIEERTMSNLRGVESDV
    Newman          KVGFMTAGHTIYLPMMSHDDVKIIEERTMSNLRGVESDV
    USA300_FPR3757  KVGFMTAGHTIYLPMMSHDDVKIIEERTMSNLRGVESDV
                    ************************* *************