From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005348000
  • symbol?: kdpB
  • description?: potassium-transporting ATPase subunit B

      descriptions from strain specific annotations:

    • potassium-transporting ATPase subunit B
    • Potassium-transporting ATPase B chain
    • K+-transporting ATPase, B subunit
    • K+-transporting ATPase subunit B
    • kdbP
    • P-ATPase superfamily P-type ATPase potassium (K+) transporter subunit B
    • putative potassium-transporting ATPase subunit B
  • strand?: -
  • coordinates?: 5520770..5522743
  • synteny block?: BlockID0041450
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2067 (kdpB)
    N315:
    SA1880 (kdpB)
    NCTC8325:
    Newman:
    NWMN_1981 (kdpB)
    USA300_FPR3757:
    04-02981:
    SA2981_2017 (kdpB)
    08BA02176:
    C248_2088 (kdbP)
    11819-97:
    MS7_2093 (kdpB)
    71193:
    ST398NM01_2117
    ECT-R 2:
    ECTR2_1932 (kdpB)
    ED133:
    SAOV_2118c
    ED98:
    SAAV_2130 (kdpB)
    HO 5096 0412:
    SAEMRSA15_19860 (kdpB)
    JH1:
    SaurJH1_2151
    JH9:
    SaurJH9_2113
    JKD6008:
    SAA6008_02115 (kdpB)
    JKD6159:
    SAA6159_01991 (kdpB)
    LGA251:
    SARLGA251_18790 (kdpB)
    M013:
    M013TW_2035
    MRSA252:
    SAR2164 (kdpB)
    MSHR1132:
    SAMSHR1132_19010
    MSSA476:
    SAS1981
    Mu3:
    SAHV_2061 (kdpB)
    Mu50:
    SAV2076 (kdpB)
    MW2:
    MW2000 (kdpB)
    RF122:
    SAB1961c (kdpB)
    ST398:
    SAPIG2117 (kdpB)
    T0131:
    SAT0131_02235 (pgi)
    TCH60:
    HMPREF0772_11119 (kdpB)
    TW20:
    SATW20_22160 (kdpB)
    USA300_TCH1516:
    USA300HOU_2071 (kdpB)
    VC40:
    SAVC_09265

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MHHVNKYFNQTMVIEALKMSFYKLNLKQLIKNPIMFVVEVGMILTLILICFPDIFGTSYL
    N315            MHHVNKYFNQTMVIEALKMSFYKLNPKQLIKNPIMFVVEVGMVLTLILICFPDIFGTSYL
    NCTC8325        ------------------MSFYKLNLKQLIKNPIMFVVEVGMILTLILICFPDIFGTSYL
    Newman          MHHVNKYFNQTMVIEALKMSFYKLNLKQLIKNPIMFVVEVGMILTLILICFPDIFGTSYL
    USA300_FPR3757  ------------------MSFYKLNLKQLIKNPIMFVVEVGMILTLILICFPDIFGTSYL
                                      ******* ****************:*****************

    COL             SRGYLITIFIILLITILFANFSEAFAEGRGKAQADSLRQAQSNLTARLIEENGAYRIVNA
    N315            SRGYLITIFIILLITILFANFSEAFAEGRGKAQADSLRQAQSNLTARLIEENGAYRIVNA
    NCTC8325        SRGYLITIFIILLITILFANFSEAFAEGRGKAQADSLRQAQSNLTARLIEENGAYRIVNA
    Newman          SRGYLITIFIILLITILFANFSEAFAEGRGKAQADSLRQAQSNLTARLIEENGAYRIVNA
    USA300_FPR3757  SRGYLITIFIILLITILFANFSEAFAEGRGKAQADSLRQAQSNLTARLIEENGAYRIVNA
                    ************************************************************

    COL             TELKAGQNIRVENGETIPADGVVINGLATVDESAITGESAPVIKESGGDFDGVIGGTLVT
    N315            TELKAGQNIRVENGETIPADGVVINGLATVDESAITGESAPVIKESGGDFDGVIGGTLVT
    NCTC8325        TELKAGQNIRVENGETIPADGVVINGLATVDESAITGESAPVIKESGGDFDGVIGGTLVT
    Newman          TELKAGQNIRVENGETIPADGVVINGLATVDESAITGESAPVIKESGGDFDGVIGGTLVT
    USA300_FPR3757  TELKAGQNIRVENGETIPADGVVINGLATVDESAITGESAPVIKESGGDFDGVIGGTLVT
                    ************************************************************

    COL             SDWLEIRVESEAGTSFLDKMIALVEGAERNKTPNEIALFTLLTTLTIIFLVVIVTLYPIA
    N315            SDWLEIRVESEAGTSFLDKMIALVEGAERNKTPNEIALFTLLTTLTIIFLVVIVTLYPIA
    NCTC8325        SDWLEIRVESEAGTSFLDKMIALVEGAERNKTPNEIALFTLLTTLTIIFLVVIVTLYPIA
    Newman          SDWLEIRVESEAGTSFLDKMIALVEGAERNKTPNEIALFTLLTTLTIIFLVVIVTLYPIA
    USA300_FPR3757  SDWLEIRVESEAGTSFLDKMIALVEGAERNKTPNEIALFTLLTTLTIIFLVVIVTLYPIA
                    ************************************************************

    COL             SYLHLILPIAMLIALTVCLIPTTIGGLLSAIGIAGMDRVTQFNVLAKSGRAVEVCGDVDV
    N315            SYLHLILPIAMLIALTVCLIPTTIGGLLSAIGIAGMDRVTQFNVLAKSGRAVEVCGDVDV
    NCTC8325        SYLHLILPIAMLIALTVCLIPTTIGGLLSAIGIAGMDRVTQFNVLAKSGRAVEVCGDVDV
    Newman          SYLHLILPIAMLIALTVCLIPTTIGGLLSAIGIAGMDRVTQFNVLAKSGRAVEVCGDVDV
    USA300_FPR3757  SYLHLILPIAMLIALTVCLIPTTIGGLLSAIGIAGMDRVTQFNVLAKSGRAVEVCGDVDV
                    ************************************************************

    COL             MILDKTGTITYGNRIASEFLPVNQQMLEKLIVAAYMSSIYDDTPEGKSIVRLAKQMYINE
    N315            MILDKTGTITYGNRIASEFLPVNQQMLEKLIVAAYMSSIYDDTPEGKSIVRLAKQMYINE
    NCTC8325        MILDKTGTITYGNRIASEFLPVNQQMLEKLIVAAYMSSIYDDTPEGKSIVRLAKQMYINE
    Newman          MILDKTGTITYGNRIASEFLPVNQQMLEKLIVAAYMSSIYDDTPEGKSIVRLAKQMYINE
    USA300_FPR3757  MILDKTGTITYGNRIASEFLPVNQQMLEKLIVAAYMSSIYDDTPEGKSIVRLAKQMYINE
                    ************************************************************

    COL             LPKDIDGTYKPFTAETRMSGIITNEISVFKGAPNSMINLVKQQQGNIPLNIESLCMDVSS
    N315            LPKDIDGTYKPFTAETRMSGIITNEISVFKGAPNSMINLVKQQQGNIPLNIESLCMDVSS
    NCTC8325        LPKDIDGTYKPFTAETRMSGIITNEISVFKGAPNSMINLVKQQQGNIPLNIESLCMDVSS
    Newman          LPKDIDGTYKPFTAETRMSGIITNEISVFKGAPNSMINLVKQQQGNIPLNIESLCMDVSS
    USA300_FPR3757  LPKDIDGTYKPFTAETRMSGIITNEISVFKGAPNSMINLVKQQQGNIPLNIESLCMDVSS
                    ************************************************************

    COL             KGGTPLIVIENNVMLGVIYLKDVIKDGLVERFTELRKMGIETVMCTGDNALTAATIAKEA
    N315            KGGTPLIVIENNVMLGVIYLKDVIKDGLVERFTELRKMGIETVMCTGDNALTAATIAKEA
    NCTC8325        KGGTPLIVIENNVMLGVIYLKDVIKDGLVERFTELRKMGIETVMCTGDNALTAATIAKEA
    Newman          KGGTPLIVIENNVMLGVIYLKDVIKDGLVERFTELRKMGIETVMCTGDNALTAATIAKEA
    USA300_FPR3757  KGGTPLIVIENNVMLGVIYLKDVIKDGLVERFTELRKMGIETVMCTGDNALTAATIAKEA
                    ************************************************************

    COL             GVDRFVAECKPEDKIKVIKDEQAKGHIVAMTGDGTNDAPALAQANIGLAMNSGTISAKEA
    N315            GVDRFVAECKPEDKIKVIKDEQAKGHIVAMTGDGTNDAPALAQANIGLAMNSGTISAKEA
    NCTC8325        GVDRFVAECKPEDKIKVIKDEQAKGHIVAMTGDGTNDAPALAQANIGLAMNSGTISAKEA
    Newman          GVDRFVAECKPEDKIKVIKDEQAKGHIVAMTGDGTNDAPALAQANIGLAMNSGTISAKEA
    USA300_FPR3757  GVDRFVAECKPEDKIKVIKDEQAKGHIVAMTGDGTNDAPALAQANIGLAMNSGTISAKEA
                    ************************************************************

    COL             ANLIDLDSNPTKLIEVVKIGKQLLMTRGALTTFSLANDVAKYFAILPALMMSTIPEMTSL
    N315            ANLIDLDSNPTKLIEVVKIGKQLLMTRGALTTFSLANDVAKYFAILPALMMSTIPEMTSL
    NCTC8325        ANLIDLDSNPTKLIEVVKIGKQLLMTRGALTTFSLANDVAKYFAILPALMMSTIPEMTSL
    Newman          ANLIDLDSNPTKLIEVVKIGKQLLMTRGALTTFSLANDVAKYFAILPALMMSTIPEMTSL
    USA300_FPR3757  ANLIDLDSNPTKLIEVVKIGKQLLMTRGALTTFSLANDVAKYFAILPALMMSTIPEMTSL
                    ************************************************************

    COL             NIMHLSSPKSAIISALIFNALIIVALIPIAMKGVKVKGYSIDRIFINNMLIYGLGGLIVP
    N315            NIMHLSSPKSAIISALIFNALIIVALIPIAMKGVKVKGYSIDRIFINNMLIYGLGGLIVP
    NCTC8325        NIMHLSSPKSAIISALIFNALIIVALIPIAMKGVKVKGYSIDRIFINNMLIYGLGGLIVP
    Newman          NIMHLSSPKSAIISALIFNALIIVALIPIAMKGVKVKGYSIDRIFINNMLIYGLGGLIVP
    USA300_FPR3757  NIMHLSSPKSAIISALIFNALIIVALIPIAMKGVKVKGYSIDRIFINNMLIYGLGGLIVP
                    ************************************************************

    COL             FLGIKLIDMIVQFFV
    N315            FLGIKLIDMIVQFFV
    NCTC8325        FLGIKLIDMIVQFFV
    Newman          FLGIKLIDMIVQFFV
    USA300_FPR3757  FLGIKLIDMIVQFFV
                    ***************