From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005351000
  • symbol?: kdpD
  • description?: sensor histidine kinase

      descriptions from strain specific annotations:

    • sensor histidine kinase
    • sensor histidine kinase KdpD
    • sensor protein KdpD
    • sensor histidine kinase, KdpD
    • osmosensitive K+ channel signal transduction histidine kinase
    • his Kinase A (phosphoacceptor) domain protein
    • histidine kinase-, DNA gyrase B-, and HSP90-like ATPase family protein
    • osmosensitive K+ channel histidine kinase
    • Osmosensitive K+ channel histidine kinase KdpD
    • osmosensitive K channel His kinase sensor
    • sensor kinase protein
    • two component sensor protein
  • strand?: +
  • coordinates?: 5524744..5527348
  • synteny block?: BlockID0041480
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2070 (kdpD)
    N315:
    SA1882 (kdpD)
    NCTC8325:
    Newman:
    NWMN_1983 (kdpD)
    USA300_FPR3757:
    04-02981:
    SA2981_2019 (kdpD)
    08BA02176:
    C248_2090 (kdpD)
    11819-97:
    MS7_2095
    71193:
    ST398NM01_2120
    ECT-R 2:
    ECTR2_1934
    ED133:
    SAOV_2120
    ED98:
    SAAV_2133 (kdpD)
    HO 5096 0412:
    SAEMRSA15_19880 (kdpD)
    JH1:
    SaurJH1_2153
    JH9:
    SaurJH9_2115
    JKD6008:
    SAA6008_02117 (kdpD)
    JKD6159:
    SAA6159_01993 (kdpD)
    LGA251:
    SARLGA251_18810 (kdpD)
    M013:
    M013TW_2037
    MRSA252:
    SAR2166 (kdpD)
    MSHR1132:
    SAMSHR1132_19030
    MSSA476:
    SAS1983
    Mu3:
    SAHV_2063 (kdpD)
    Mu50:
    SAV2078 (kdpD)
    MW2:
    MW2002 (kdpD)
    RF122:
    SAB1963 (kdpD)
    ST398:
    SAPIG2120
    T0131:
    SAT0131_02237
    TCH60:
    HMPREF0772_11116 (kdpD)
    TW20:
    SATW20_22180 (kdpD)
    USA300_TCH1516:
    USA300HOU_2074 (kdpD)
    VC40:
    SAVC_09275

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSNTESLNIGKKRGSLTIYIGYSPGVGKTFEMLSNAIELFQSNVDIKIGYIEPHQRDETN
    N315            MSNTESLNIGKKRGSLTIYIGYSPGVGKTFEMLSNAIELFQSNVDIKIGYIEPHQRDETN
    NCTC8325        MSNTESLNIGKKRGSLTIYIGYSPGVGKTFEMLSNAIELFQSNVDIKIGYIEPHQRDETN
    Newman          MSNTESLNIGKKRGSLTIYIGYSPGVGKTFEMLSNAIELFQSNVDIKIGYIEPHQRDETN
    USA300_FPR3757  MSNTESLNIGKKRGSLTIYIGYSPGVGKTFEMLSNAIELFQSNVDIKIGYIEPHQRDETN
                    ************************************************************

    COL             ALAEQLPKITTNFTKHGSHHFQYLDVDRIIEESPTIVLIDELAHTNISRDRHEKRYMDIE
    N315            ALAEQLPKITTNFTKHGSHHFQYLDVDRIIEESPTIVLIDELAHTNISRDRHEKRYMDIE
    NCTC8325        ALAEQLPKITTNFTKHGSHHFQYLDVDRIIEESPTIVLIDELAHTNISRDRHEKRYMDIE
    Newman          ALAEQLPKITTNFTKHGSHHFQYLDVDRIIEESPTIVLIDELAHTNISRDRHEKRYMDIE
    USA300_FPR3757  ALAEQLPKITTNFTKHGSHHFQYLDVDRIIEESPTIVLIDELAHTNISRDRHEKRYMDIE
                    ************************************************************

    COL             EILNHGIDVHTTLNIQHIESLSSQIELMTGVHVKERVPDYFIMSADVLEVVDISPEQLIK
    N315            EILNHGIDVHTTLNIQHIESLSSQIELMTGVHVKERVPDYFIMSADVLEVVDISPEQLIK
    NCTC8325        EILNHGIDVHTTLNIQHIESLSSQIELMTGVHVKERVPDYFIMSADVLEVVDISPEQLIK
    Newman          EILNHGIDVHTTLNIQHIESLSSQIELMTGVHVKERVPDYFIMSADVLEVVDISPEQLIK
    USA300_FPR3757  EILNHGIDVHTTLNIQHIESLSSQIELMTGVHVKERVPDYFIMSADVLEVVDISPEQLIK
                    ************************************************************

    COL             RLKAGKVYKKDRLDVAFSNFFTYAHLSELRTLTLRTVADLMSDKEKVRHNHKTSLKPHIA
    N315            RLKAGKVYKKDRLDVAFSNFFTYAHLSELRTLTLRTVADLMSDKEKVRHNHKTSLKPHIA
    NCTC8325        RLKAGKVYKKDRLDVAFSNFFTYAHLSELRTLTLRTVADLMSDKEKVRHNHKTSLKPHIA
    Newman          RLKAGKVYKKDRLDVAFSNFFTYAHLSELRTLTLRTVADLMSDKEKVRHNHKTSLKPHIA
    USA300_FPR3757  RLKAGKVYKKDRLDVAFSNFFTYAHLSELRTLTLRTVADLMSDKEKVRHNHKTSLKPHIA
                    ************************************************************

    COL             VAISGSIYNEAVIKEAFHIAQKEHAKFTAIYIDVFEKNRQYKDSQKQVHQHLMLAKSLGA
    N315            VAISGSIYNEAVIKEAFHIAQKEHAKFTAIYIDVFEKNRQYKDSQKQVHQHLMLAKSLGA
    NCTC8325        VAISGSIYNEAVIKEAFHIAQKEHAKFTAIYIDVFEKNRQYKDSQKQVHQHLMLAKSLGA
    Newman          VAISGSIYNEAVIKEAFHIAQKEHAKFTAIYIDVFEKNRQYKDSQKQVHQHLMLAKSLGA
    USA300_FPR3757  VAISGSIYNEAVIKEAFHIAQKEHAKFTAIYIDVFEKNRQYKDSQKQVHQHLMLAKSLGA
                    ************************************************************

    COL             KVKVVYSQTVALGLDEWCKNQDVTKLIIGQHIRNKWRDFFNTPLIDHLMSFEHSYKIEIV
    N315            KVKVVYSQTVALGLDEWCKNQDVTKLIIGQHIRNKWRDFFNTPLIDHLMSFEHSYKIEIV
    NCTC8325        KVKVVYSQTVALGLDEWCKNQDVTKLIIGQHIRNKWRDFFNTPLIDHLMSFEHSYKIEIV
    Newman          KVKVVYSQTVALGLDEWCKNQDVTKLIIGQHIRNKWRDFFNTPLIDHLMSFEHSYKIEIV
    USA300_FPR3757  KVKVVYSQTVALGLDEWCKNQDVTKLIIGQHIRNKWRDFFNTPLIDHLMSFEHSYKIEIV
                    ************************************************************

    COL             PIKQIPVELKMNKSPYRPKGKRFAIDMLKMILIQIICVMMGLWIYQLDKHESSTIILMIF
    N315            PIKQIPVELKMNKSPYRPKGKRFAIDMLKMILIQIICVMMGLWIYQLDKHESSTIILMIF
    NCTC8325        PIKQIPVELKMNKSPYRPKGKRFAIDMLKMILIQIICVMMGLWIYQLDKHESSTIILMIF
    Newman          PIKQIPVELKMNKSPYRPKGKRFAIDMLKMILIQIICVMMGLWIYQLDKHESSTIILMIF
    USA300_FPR3757  PIKQIPVELKMNKSPYRPKGKRFAIDMLKMILIQIICVMMGLWIYQLDKHESSTIILMIF
                    ************************************************************

    COL             LIGIILLSIWTRSFIIGFLAAIINVFVFNYFFTEPRYTFEVYRFDYPITFIVSILTSILT
    N315            LIGIILLSIWTRSFIIGFLAAIINVFVFNYFFTEPRYTFEVYRFDYPITFIVSILTSILT
    NCTC8325        LIGIILLSIWTRSFIIGFLAAIINVFVFNYFFTEPRYTFEVYRFDYPITFIVSILTSILT
    Newman          LIGIILLSIWTRSFIIGFLAAIINVFVFNYFFTEPRYTFEVYRFDYPITFIVSILTSILT
    USA300_FPR3757  LIGIILLSIWTRSFIIGFLAAIINVFVFNYFFTEPRYTFEVYRFDYPITFIVSILTSILT
                    ************************************************************

    COL             SALLKQIKFQYSITKKQLYRTDLLFQFNDSIKQTYTVENLLINAGYQINQLLQQSITIYV
    N315            SALLKQIKFQYSITKKQLYRTDLLFQFNDSIKQTYTVENLLINAGYQINQLLQQSITIYV
    NCTC8325        SALLKQIKFQYSITKKQLYRTDLLFQFNDSIKQTYTVENLLINAGYQINQLLQQSITIYV
    Newman          SALLKQIKFQYSITKKQLYRTDLLFQFNDSIKQTYTVENLLINAGYQINQLLQQSITIYV
    USA300_FPR3757  SALLKQIKFQYSITKKQLYRTDLLFQFNDSIKQTYTVENLLINAGYQINQLLQQSITIYV
                    ************************************************************

    COL             INQSKVIKTIPLQNHIDNTTQQHEQALSWVIKNERQAGATTDTFPGINKWLIPIGTSPIK
    N315            INQSKVIKTIPLQNHIDNTTQQHEQALSWVIKNERQAGATTDTFPGINKWLIPIGTSPIK
    NCTC8325        INQSKVIKTIPLQNHIDNTTQQHEQALSWVIKNERQAGATTDTFPGINKWLIPIGTSPIK
    Newman          INQSKVIKTIPLQNHIDNTTQQHEQALSWVIKNERQAGATTDTFPGINKWLIPIGTSPIK
    USA300_FPR3757  INQSKVIKTIPLQNHIDNTTQQHEQALSWVIKNERQAGATTDTFPGINKWLIPIGTSPIK
                    ************************************************************

    COL             GILAIDYQSSQVINPYDASILESMLNELSLAVENVTLLKQTRESMLQAERQLTHSNFLRS
    N315            GILAIDYQSSQVINPYDASILESMLNELSLAVENVTLLKQTRESMLQAERQLTHSNFLRS
    NCTC8325        GILAIDYQSSQVINPYDASILESMLNELSLAVENVTLLKQTRESMLQAERQLTHSNFLRS
    Newman          GILAIDYQSSQVINPYDASILESMLNELSLAVENVTLLKQTRESMLQAERQLTHSNFLRS
    USA300_FPR3757  GILAIDYQSSQVINPYDASILESMLNELSLAVENVTLLKQTRESMLQAERQLTHSNFLRS
                    ************************************************************

    COL             ISHDIRTPLTTIMGNLDILVSHSKDMSVIEKEQLLVHSFQESQYLYLLVTNILSLTKLQS
    N315            ISHDIRTPLTTIMGNLDILVSHSKDMSIIEKEQLLVHSFQESQYLYLLVTNILSLTKLQS
    NCTC8325        ISHDIRTPLTTIMGNLDILVSHSKDMSIIEKEQLLVHSFQESQYLYLLVTNILSLTKLQS
    Newman          ISHDIRTPLTTIMGNLDILVSHSKDMSVIEKEQLLVHSFQESQYLYLLVTNILSLTKLQS
    USA300_FPR3757  ISHDIRTPLTTIMGNLDILVSHSKDMSIIEKEQLLVHSFQESQYLYLLVTNILSLTKLQS
                    ***************************:********************************

    COL             SNVQIKLQPYLVSELVEEIDMILERRHLKKRITVSSSVNLQFIHIDSKLILQALFNLIEN
    N315            SNVQIKLQPYLVSELVEEIDMILERRHLKKRITVSSSVNLQFIHIDSKLILQALFNLIEN
    NCTC8325        SNVQIKLQPYLVSELVEEIDMILERRHLKKRITVSSSVNLQFIHIDSKLILQALFNLIEN
    Newman          SNVQIKLQPYLVSELVEEIDMILERRHLKKRITVSSSVNLQFIHIDSKLILQALFNLIEN
    USA300_FPR3757  SNVQIKLQPYLVSELVEEIDMILERRHLKKRITVSSSVNLQFIHIDSKLILQALFNLIEN
                    ************************************************************

    COL             AVKHTSTDTKINLSIRYASYEQIEFAVIDEGPGISLEEQQKIFEPFYTGSNKYFKDNQKE
    N315            AVKHTSTDTKINLSIRYASYEQIEFAVIDEGPGISLEEQQKIFEPFYTGSNKYFKDNQKE
    NCTC8325        AVKHTSTDTKINLSIRYASYEQIEFAVIDEGPGISLEEQQKIFEPFYTGSNKYFKDNQKE
    Newman          AVKHTSTDTKINLSIRYASYEQIEFAVIDEGPGISLEEQQKIFEPFYTGSNKYFKDNQKE
    USA300_FPR3757  AVKHTSTDTKINLSIRYASYEQIEFAVIDEGPGISLEEQQKIFEPFYTGSNKYFKDNQKE
                    ************************************************************

    COL             SMGLGLYLVQTILHKHQSNLQYKPNQPHGSIFYFNIYTDFNEGDV
    N315            SMGLGLYLVQTILHKHQSNLQYKPNQPHGSIFYFNIYTDFNEGDV
    NCTC8325        SMGLGLYLVQTILHKHQSNLQYKPNQPHGSIFYFNIYTDFNEGDV
    Newman          SMGLGLYLVQTILHKHQSNLQYKPNQPHGSIFYFNIYTDFNEGDV
    USA300_FPR3757  SMGLGLYLVQTILHKHQSNLQYKPNQPHGSIFYFNIYTDFNEGDV
                    *********************************************