From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005352000
  • symbol?: kdpE
  • description?: DNA-binding response regulator

      descriptions from strain specific annotations:

    • DNA-binding response regulator
    • DNA-binding response regulator KdpE
    • KDP operon transcriptional regulatory protein KdpE
    • KDP operon transcriptional regulatory protein
    • DNA-binding response regulator, KdpE
    • KdpE protein
    • KDP operon response regulator KdpE
    • response regulator protein
    • response regulator receiver
    • response regulator receiver domain/transcriptional regulatory protein
    • two component sensor protein
    • Two component transcriptional regulator, winged helix family
    • winged helix family two component transcriptional regulator
  • strand?: +
  • coordinates?: 5527473..5528162
  • synteny block?: BlockID0041490
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2071 (kdpE)
    N315:
    SA1883 (kdpE)
    NCTC8325:
    Newman:
    NWMN_1984 (kdpE)
    USA300_FPR3757:
    04-02981:
    SA2981_2020 (kdpE)
    08BA02176:
    C248_2091 (kdpE)
    11819-97:
    MS7_2096
    71193:
    ST398NM01_2121
    ECT-R 2:
    ECTR2_1935
    ED133:
    SAOV_2121
    ED98:
    SAAV_2134 (kdpE)
    HO 5096 0412:
    SAEMRSA15_19890 (kdpE)
    JH1:
    SaurJH1_2154
    JH9:
    SaurJH9_2116
    JKD6008:
    SAA6008_02118 (kdpE)
    JKD6159:
    SAA6159_01994 (kdpE)
    LGA251:
    SARLGA251_18820 (kdpE)
    M013:
    M013TW_2038
    MRSA252:
    SAR2167 (kdpE)
    MSHR1132:
    SAMSHR1132_19040
    MSSA476:
    SAS1984
    Mu3:
    SAHV_2064 (kdpE)
    Mu50:
    SAV2079 (kdpE)
    MW2:
    MW2003 (kdpE)
    RF122:
    SAB1964 (kdpE)
    ST398:
    SAPIG2121
    T0131:
    SAT0131_02238
    TCH60:
    HMPREF0772_11115 (kdpE)
    TW20:
    SATW20_22190 (kdpE)
    USA300_TCH1516:
    USA300HOU_2075 (kdpE)
    VC40:
    SAVC_09280

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQSKILIIEDDHAITHLLDVALTLDYYNVTTADNATQAHFKIQIDKPDVILLDLGLPDKD
    N315            MQSKILIIEDDHAITHLLDVALTLDYYNVTTADNATQAHFKIQIDKPDVILLDLGLPDKD
    NCTC8325        MQSKILIIEDDHAITHLLDVALTLDYYNVTTADNATQAHFKIQIDKPDVILLDLGLPDKD
    Newman          MQSKILIIEDDHAITHLLDVALTLDYYNVTTADNATQAHFKIQIDKPDVILLDLGLPDKD
    USA300_FPR3757  MQSKILIIEDDHAITHLLDVALTLDYYNVTTADNATQAHFKIQIDKPDVILLDLGLPDKD
                    ************************************************************

    COL             GLCLISEIRQHTDIPIIVISARQEEQTIIQALDNGANDYMTKPFNVDELRARIRVIERIA
    N315            GLCLISEIRQHTDIPIIVISARQEEQTIIQALDNGANDYMTKPFNVDELRARIRVIERIA
    NCTC8325        GLCLISEIRQHTDIPIIVISARQEEQTIIQALDNGANDYMTKPFNVDELRARIRVIERIA
    Newman          GLCLISEIRQHTDIPIIVISARQEEQTIIQALDNGANDYMTKPFNVDELRARIRVIERIA
    USA300_FPR3757  GLCLISEIRQHTDIPIIVISARQEEQTIIQALDNGANDYMTKPFNVDELRARIRVIERIA
                    ************************************************************

    COL             KSHQETNIVFTNGLLSIDFGSKSVVINNQEVHLTPNEFSLLELLSNHKGKVLTYEMILKR
    N315            KSHQETNIVFTNGLLSIDFGSKSVVINNQEVHLTPNEFSLLELLSNHKGKVLTYEMILKR
    NCTC8325        KSHQETNIVFTNGLLSIDFGSKSVVINNQEVHLTPNEFSLLELLSNHKGKVLTYEMILKR
    Newman          KSHQETNIVFTNGLLSIDFGSKSVVINNQEVHLTPNEFSLLELLSNHKGKVLTYEMILKR
    USA300_FPR3757  KSHQETNIVFTNGLLSIDFGSKSVVINNQEVHLTPNEFSLLELLSNHKGKVLTYEMILKR
                    ************************************************************

    COL             IYGYVNKTEMPSLRVHMTSLRQKLSQCHEDAKDIIKTHPRIGYQMLQWKEK
    N315            IYGYVNKTEMPSLRVHMTSLRQKLSQCHEDAKDIIKTHPRIGYQMLQWKEK
    NCTC8325        IYGYVNKTEMPSLRVHMTSLRQKLSQCHEDAKDIIKTHPRIGYQMLQWKEK
    Newman          IYGYVNKTEMPSLRVHMTSLRQKLSQCHEDAKDIIKTHPRIGYQMLQWKEK
    USA300_FPR3757  IYGYVNKTEMPSLRVHMTSLRQKLSQCHEDAKDIIKTHPRIGYQMLQWKEK
                    ***************************************************