From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005383000
  • symbol?: ssbB
  • description?: single-stranded DNA-binding protein

      descriptions from strain specific annotations:

    • single-stranded DNA-binding protein
    • ssDNA-binding protein
    • bacteriophage L54a single-stranded DNA binding protein
    • single-stranded DNA- binding protein family
    • bacteriophage L54a, single-stranded DNA binding protein
    • putative single strand DNA-binding protein
    • single-strand binding protein
    • single-strand binding protein family
    • single strand DNA binding protein
    • single-stranded DNA-binding family protein
  • strand?: -
  • coordinates?: 5548991..5549386
  • synteny block?: BlockID0041800
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2037
    08BA02176:
    C248_2111
    11819-97:
    MS7_2113
    71193:
    ST398NM01_2139
    ECT-R 2:
    ECTR2_1953 (ssb)
    ED133:
    SAOV_2138c
    ED98:
    SAAV_2152
    HO 5096 0412:
    SAEMRSA15_20050
    JH1:
    SaurJH1_2171
    JH9:
    SaurJH9_2133
    JKD6008:
    SAA6008_02135
    JKD6159:
    SAA6159_02010
    LGA251:
    SARLGA251_18980
    M013:
    M013TW_2054
    MRSA252:
    SAR2185
    MSHR1132:
    SAMSHR1132_19200
    MSSA476:
    SAS2000
    Mu3:
    SAHV_2081
    Mu50:
    SAV2096
    MW2:
    MW2021
    RF122:
    SAB1981c
    ST398:
    SAPIG2139
    T0131:
    SAT0131_02257
    TCH60:
    HMPREF0772_11095
    TW20:
    SATW20_22350
    USA300_TCH1516:
    VC40:
    SAVC_09360

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLNKIVIVGRLTKDAQIFEKEDRKIATFCVATHRNYKDENGEIVCDYLFCKAFGKLASNI
    N315            MLNKIVIVGRLTKDAQIFEKEDRKIATFCVATHRNYKDENGEIVCDYLFCKAFGKLASNI
    NCTC8325        MLNKIVIVGRLTKDAQIFEKEDRKIATFCVATHRNYKDENGEIVCDYLFCKAFGKLASNI
    Newman          MLNKIVIVGRLTKDAQIFEKEDRKIATFCVATHRNYKDENGEIVCDYLFCKAFGKLASNI
    USA300_FPR3757  MLNKIVIVGRLTKDAQIFEKEDRKIATFCVATHRNYKDENGEIVCDYLFCKAFGKLASNI
                    ************************************************************

    COL             EKYTNQGTLVGITGQMRSRKYDKDGQTHFVTELYVETIKFMSPKSQNNEILSDSILDIDS
    N315            EKYTNQGTLVGITGQMRSRKYDKDGQTHFVTELYVETIKFMSPKSQNNEILSDSILDIDS
    NCTC8325        EKYTNQGTLVGITGQMRSRKYDKDGQTHFVTELYVETIKFMSPKSQNNEILSDSILDIDS
    Newman          EKYTNQGTLVGITGQMRSRKYDKDGQTHFVTELYVETIKFMSPKSQNNEILSDSILDIDS
    USA300_FPR3757  EKYTNQGTLVGITGQMRSRKYDKDGQTHFVTELYVETIKFMSPKSQNNEILSDSI-----
                    *******************************************************     

    COL             QNIDNHDLLEI
    N315            QNIDNHDLLEI
    NCTC8325        QNIDNHDLLEI
    Newman          QNIDNHDLLEI
    USA300_FPR3757  -----------