From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005386000
  • symbol?: ywpF
  • description?: ywpF protein

      descriptions from strain specific annotations:

    • ywpF protein
    • YwpF family protein
  • strand?: +
  • coordinates?: 5551723..5552227
  • synteny block?: BlockID0041820
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2090 (ywpF)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2038
    08BA02176:
    C248_2112
    11819-97:
    MS7_2114 (ywpF)
    71193:
    ST398NM01_2140
    ECT-R 2:
    ECTR2_1954
    ED133:
    SAOV_2139
    ED98:
    SAAV_2153 (ywpF)
    HO 5096 0412:
    SAEMRSA15_20060
    JH1:
    SaurJH1_2172
    JH9:
    SaurJH9_2134
    JKD6008:
    SAA6008_02136 (ywpF)
    JKD6159:
    SAA6159_02011 (ywpF)
    LGA251:
    SARLGA251_18990
    M013:
    M013TW_2057
    MRSA252:
    SAR2186
    MSHR1132:
    SAMSHR1132_19210
    MSSA476:
    SAS2001
    Mu3:
    SAHV_2082
    Mu50:
    SAV2097
    MW2:
    MW2022
    RF122:
    SAB1982
    ST398:
    SAPIG2140
    T0131:
    SAT0131_02258
    TCH60:
    HMPREF0772_11094 (ywpF)
    TW20:
    SATW20_22360
    USA300_TCH1516:
    USA300HOU_2088
    VC40:
    SAVC_09365

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---------------------MKTFKAVRFQIVNEHGRIIEYELEDGVIINKEESGTGWL
    N315            ---------------------MKTFKAVRFQIVNEHGRIIEYELEDGVIINKEESGTGWL
    NCTC8325        MTLNLLNNSKIINIKLMGCGNMKTFKAVRFQIVNEHGRIIEYELEDGVIINKEESGTGWL
    Newman          MTLNLLNNSKIINIKLMGCGNMKTFKAVRFQIVNEHGRIIEYELEDGVIINKEESGTGWL
    USA300_FPR3757  ---------------------MKTFKAVRFQIVNEHGRIIEYELEDGVIINKEESGTGWL
                                         ***************************************

    COL             LEIVISNEHYETFKEYQDNEQLLDIRVVITRPANDPALFESTVKSIKNFKTTMSIVFECH
    N315            LEIVISNEHYETFKEYQDNEQLLDIRVVITRPANDPALFESTVKSIKNFKTTMSIVFECH
    NCTC8325        LEIVISNEHYETFKEYQDNEQLLDIRVVITRPANDPALFESTVKSIKNFKTTMSIVFECH
    Newman          LEIVISNEHYETFKEYQDNEQLLDIRVVITRPANDPALFESTVKSIKNFKTTMSIVFECH
    USA300_FPR3757  LEIVISNEHYETFKEYQDNEQLLDIRVVITRPANDPALFESTVKSIKNFKTTMSIVFECH
                    ************************************************************

    COL             IYTLRQQYAESLLEQLIDDGLSGEELKKSFNRMMQSKPKLKDEKLEE
    N315            IYTLRQQYAESLLEQLIDDGLSGEELKKSFNRMMQSKPKLKDEKLEE
    NCTC8325        IYTLRQQYAESLLEQLIDDGLSGEELKKSFNRMMQSKPKLKDEKLEE
    Newman          IYTLRQQYAESLLEQLIDDGLSGEELKKSFNRMMQSKPKLKDEKLEE
    USA300_FPR3757  IYTLRQQYAESLLEQLIDDGLSGEELKKSFNRMMQSKPKLKDEKLEE
                    ***********************************************