From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005387000
  • symbol?: fabZ
  • description?: (3R)-hydroxymyristoyl-ACP dehydratase

      descriptions from strain specific annotations:

    • (3R)-hydroxymyristoyl-ACP dehydratase
    • (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
    • beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
    • putative hydroxymyristoyl-(acyl carrier protein)dehydratase
    • (3R)-hydroxymyristoyl-dehydratase
    • (3R)-hydroxyacyl-[acyl carrier protein] dehydratase
    • 3R-hydroxymyristoyl ACP dehydratase
  • strand?: -
  • coordinates?: 5552286..5552726
  • synteny block?: BlockID0041830
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2091 (fabZ)
    N315:
    SA1901 (fabZ)
    NCTC8325:
    Newman:
    NWMN_2003 (fabZ)
    USA300_FPR3757:
    04-02981:
    SA2981_2039
    08BA02176:
    C248_2113 (fabZ)
    11819-97:
    MS7_2115 (fabZ)
    71193:
    ST398NM01_2141
    ECT-R 2:
    ECTR2_1955 (fabZ)
    ED133:
    SAOV_2140c
    ED98:
    SAAV_2154 (fabZ)
    HO 5096 0412:
    SAEMRSA15_20070 (fabZ)
    JH1:
    SaurJH1_2173 (fabZ)
    JH9:
    SaurJH9_2135 (fabZ)
    JKD6008:
    SAA6008_02137 (fabZ)
    JKD6159:
    SAA6159_02012 (fabZ)
    LGA251:
    SARLGA251_19000 (fabZ)
    M013:
    M013TW_2058
    MRSA252:
    SAR2187 (fabZ)
    MSHR1132:
    SAMSHR1132_19220
    MSSA476:
    SAS2002 (fabZ)
    Mu3:
    SAHV_2083 (fabZ)
    Mu50:
    SAV2098 (fabZ)
    MW2:
    MW2023 (fabZ)
    RF122:
    SAB1983c (fabZ)
    ST398:
    SAPIG2141 (fabZ)
    T0131:
    SAT0131_02259
    TCH60:
    HMPREF0772_11093 (fabZ)
    TW20:
    SATW20_22370 (fabZ)
    USA300_TCH1516:
    USA300HOU_2089 (fabZ)
    VC40:
    SAVC_09370 (fabZ)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             METIFDYNQIKQIIPHRQPFLLIDKVVEYEEGQRCVAIKQVSGNEPFFQGHFPEYAVMPG
    N315            METIFDYNQIKQIIPHRQPFLLIDKVVEYEEGQRCVAIKQVSGNEPFFQGHFPEYAVMPG
    NCTC8325        METIFDYNQIKQIIPHRQPFLLIDKVVEYEEGQRCVAIKQVSGNEPFFQGHFPEYAVMPG
    Newman          METIFDYNQIKQIIPHRQPFLLIDKVVEYEEGQRCVAIKQVSGNEPFFQGHFPEYAVMPG
    USA300_FPR3757  METIFDYNQIKQIIPHRQPFLLIDKVVEYEEGQRCVAIKQVSGNEPFFQGHFPEYAVMPG
                    ************************************************************

    COL             VLITEALAQTGAVAILNSEENKGKIALFAGIDKCRFKRQVVPGDTLTLEVEITKIKGPIG
    N315            VLITEALAQTGAVAILNSEENKGKIALFAGIDKCRFKRQVVPGDTLTLEVEITKIKGPIG
    NCTC8325        VLITEALAQTGAVAILNSEENKGKIALFAGIDKCRFKRQVVPGDTLTLEVEITKIKGPIG
    Newman          VLITEALAQTGAVAILNSEENKGKIALFAGIDKCRFKRQVVPGDTLTLEVEITKIKGPIG
    USA300_FPR3757  VLITEALAQTGAVAILNSEENKGKIALFAGIDKCRFKRQVVPGDTLTLEVEITKIKGPIG
                    ************************************************************

    COL             KGNAKATVDGQLACSCELTFAIQDVK
    N315            KGNAKATVDGQLACSCELTFAIQDVK
    NCTC8325        KGNAKATVDGQLACSCELTFAIQDVK
    Newman          KGNAKATVDGQLACSCELTFAIQDVK
    USA300_FPR3757  KGNAKATVDGQLACSCELTFAIQDVK
                    **************************