From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005412000
  • symbol?: rpmE2
  • description?: 50S ribosomal protein L31

      descriptions from strain specific annotations:

    • 50S ribosomal protein L31
    • 50S ribosomal protein L31 type B
    • putative 50S ribosomal protein L31
    • 50S ribosomalprotein L31p
  • strand?: -
  • coordinates?: 5570920..5571174
  • synteny block?: BlockID0042080
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2112 (rpmE2)
    N315:
    SA1922 (rpmE2)
    NCTC8325:
    SAOUHSC_02361 (rpmE2)
    Newman:
    NWMN_2024 (rpmE2)
    USA300_FPR3757:
    SAUSA300_2074 (rpmE2)
    04-02981:
    SA2981_2060 (rpmE)
    08BA02176:
    C248_2134 (rpmE)
    11819-97:
    MS7_2136 (rpmE)
    71193:
    ST398NM01_2162
    ECT-R 2:
    ECTR2_1976 (rpmE)
    ED133:
    SAOV_2161c
    ED98:
    SAAV_2175 (rpmE2)
    HO 5096 0412:
    SAEMRSA15_20280 (rpmE)
    JH1:
    SaurJH1_2194 (rpmE2)
    JH9:
    SaurJH9_2156 (rpmE2)
    JKD6008:
    SAA6008_02158 (rpmE2)
    JKD6159:
    SAA6159_02034 (rpmE2)
    LGA251:
    SARLGA251_19210 (rpmE)
    M013:
    M013TW_2079
    MRSA252:
    SAR2208 (rpmE2)
    MSHR1132:
    SAMSHR1132_19430
    MSSA476:
    SAS2023 (rpmE2)
    Mu3:
    SAHV_2104 (rpmE2)
    Mu50:
    SAV2120 (rpmE2)
    MW2:
    MW2044 (rpmE2)
    RF122:
    SAB2004c (rpmE2)
    ST398:
    SAPIG2162 (rpmE)
    T0131:
    SAT0131_02283
    TCH60:
    HMPREF0772_11070 (rpmE)
    TW20:
    SATW20_22580 (rpmE)
    USA300_TCH1516:
    USA300HOU_2108 (rpmE2)
    VC40:
    SAVC_09475 (rpmE2)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKQGIHPEYHQVIFLDTTTNFKFLSGSTKTSSEMMEWEDGKEYPVIRLDISSDSHPFYTG
    N315            MKQGIHPEYHQVIFLDTTTNFKFLSGSTKTSSEMMEWEDGKEYPVIRLDISSDSHPFYTG
    NCTC8325        MKQGIHPEYHQVIFLDTTTNFKFLSGSTKTSSEMMEWEDGKEYPVIRLDISSDSHPFYTG
    Newman          MKQGIHPEYHQVIFLDTTTNFKFLSGSTKTSSEMMEWEDGKEYPVIRLDISSDSHPFYTG
    USA300_FPR3757  MKQGIHPEYHQVIFLDTTTNFKFLSGSTKTSSEMMEWEDGKEYPVIRLDISSDSHPFYTG
                    ************************************************************

    COL             RQKFAAADGRVERFNKKFGLKSNN
    N315            RQKFAAADGRVERFNKKFGLKSNN
    NCTC8325        RQKFAAADGRVERFNKKFGLKSNN
    Newman          RQKFAAADGRVERFNKKFGLKSNN
    USA300_FPR3757  RQKFAAADGRVERFNKKFGLKSNN
                    ************************