From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005415000
  • symbol?:
  • description?: transcriptional regulator

      descriptions from strain specific annotations:

    • transcriptional regulator
    • HxlR family transcriptional regulator
    • hxlR-like helix-turn-helix family protein
    • MarR family transcriptional regulator
    • putative transcriptional regulator
    • putative transcriptional regulator superfamily
    • transcription regulator
  • strand?: -
  • coordinates?: 5574524..5574745
  • synteny block?: BlockID0042110
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2063
    08BA02176:
    C248_2137
    11819-97:
    MS7_2139
    71193:
    ST398NM01_2165
    ECT-R 2:
    ECTR2_1979
    ED133:
    SAOV_2164c
    ED98:
    SAAV_2178
    HO 5096 0412:
    SAEMRSA15_20310
    JH1:
    SaurJH1_2197
    JH9:
    SaurJH9_2159
    JKD6008:
    SAA6008_02161
    JKD6159:
    SAA6159_02037
    LGA251:
    SARLGA251_19240
    M013:
    M013TW_2082
    MRSA252:
    SAR2211
    MSHR1132:
    SAMSHR1132_19460
    MSSA476:
    SAS2026
    Mu3:
    SAHV_2107
    Mu50:
    SAV2123
    MW2:
    MW2047
    RF122:
    SAB2007c
    ST398:
    SAPIG2165
    T0131:
    SAT0131_02286
    TCH60:
    HMPREF0772_11067
    TW20:
    SATW20_22610
    USA300_TCH1516:
    USA300HOU_2111
    VC40:
    SAVC_09490

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -MEVCPYLEETFKILGRSWNGLIINYLSRCNDCSAHFSDMKRDLKTITPRALSLKLSELA
    N315            MMEVCPYLEETFKILGRSWNGLIINYLSRCNDCSAHFSDMKRDLKTITPRALSLKLSELA
    NCTC8325        -MEVCPYLEETFKILGRSWNGLIINYLSRCNDCSAHFSDMKRDLKTITPRALSLKLSELA
    Newman          MMEVCPYLEETFKILGRSWNGLIINYLSRCNDCSAHFSDMKRDLKTITPRALSLKLSELA
    USA300_FPR3757  -MEVCPYLEETFKILGRSWNGLIINYLSRCNDCSAHFSDMKRDLKTITPRALSLKLSELA
                     ***********************************************************

    COL             QWELVEKQIISTSPVQIIYVLTEKGKALAEALHPIEAWAQSYVDLTDQRTAK
    N315            QWELVEKQIISTSPVQIIYVLTEKGKALAEALHPIEAWAQSYVDLTDQRTAK
    NCTC8325        QWELVEKQIISTSPVQIIYVLTEKGKALAEALHPIEAWAQSYVDLTDQRTAK
    Newman          QWELVEKQIISTSPVQIIYVLTEKGKALAEALHPIEAWAQSYVDLTDQRTAK
    USA300_FPR3757  QWELVEKQIISTSPVQIIYVLTEKGKALAEALHPIEAWAQSYVDLTDQRTAK
                    ****************************************************