From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005431000
  • symbol?:
  • description?: membrane protein

      descriptions from strain specific annotations:

    • membrane protein
    • Membrane protein-like protein
    • membrane spanning protein
  • strand?: -
  • coordinates?: 5590143..5590493
  • synteny block?: BlockID0042260
  • occurrence?: in 91% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2075
    08BA02176:
    C248_2150
    11819-97:
    MS7_2153
    71193:
    ST398NM01_2177
    ECT-R 2:
    ECTR2_1991
    ED133:
    ED98:
    SAAV_2190
    HO 5096 0412:
    SAEMRSA15_20430
    JH1:
    SaurJH1_2209
    JH9:
    SaurJH9_2171
    JKD6008:
    JKD6159:
    SAA6159_02049
    LGA251:
    SARLGA251_19360
    M013:
    M013TW_2094
    MRSA252:
    SAR2223
    MSHR1132:
    SAMSHR1132_19580
    MSSA476:
    SAS2038
    Mu3:
    SAHV_2119
    Mu50:
    SAV2135
    MW2:
    MW2059
    RF122:
    SAB2019c
    ST398:
    SAPIG2177
    T0131:
    SAT0131_02299
    TCH60:
    HMPREF0772_11055
    TW20:
    SATW20_22730
    USA300_TCH1516:
    USA300HOU_2124
    VC40:
    SAVC_09550

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNILRYLLGIGFSVIGVLHFTRERQFRNIIPKCLTLRKTAVLVTGIFEILFGLALLIKRP
    N315            MNILRYLLGIGFSVIGVLHFTRERQFRNIIPKCLPLRKTAVLVTGIFEILFGLALLIKRP
    NCTC8325        MNILRYLLGIGFSVIGVLHFTRERQFRNIIPKCLPLRKTAVLVTGIFEILFGLALLIKRP
    Newman          MNILRYLLGIGFSVIGVLHFTRERQFRNIIPKCLPLRKTAVLVTGIFEILFGLALLIKRP
                    **********************************.*************************

    COL             SQCLKNTINLFLLAVFPANIYMAVKKLPLGDKQLPTWQLYLRLPMQFVLMGLIKKL
    N315            SQCLKNTINLFLLAVFPANIYMAVKKLPLGDKQLPTWQLYLRLPMQFVLMGLIKKL
    NCTC8325        SQCLKNTINLFLLAVFPANIYMAVKKLPLGDKQLPTWQLYLRLPMQFVLMGLIKKL
    Newman          SQCLKNTINLFLLAVFPANIYMAVKKLPLGDKQLPTWQLYLRLPMQFVLMGLIKKL
                    ********************************************************