From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005436000
  • symbol?: dps
  • description?: DNA starvation/stationary phase protection protein

      descriptions from strain specific annotations:

    • DNA starvation/stationary phase protection protein
    • general stress protein 20U
    • Dps family protein
    • DNA protection during starvation protein 1
    • DNA protection during starvation protein 2
    • Dps family stress protein
    • Ferritin, Dps family protein
    • ferritin Dps family protein
    • metalloregulation DNA-binding stress protein
    • non-heme iron-containing ferritin
    • Non-specific DNA-binding protein Dps / Iron-binding ferritin-like antioxidant protein / Ferroxidase
    • putative non-heme iron-containing ferritin
  • strand?: -
  • coordinates?: 5594823..5595266
  • synteny block?: BlockID0042310
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1941 (dps)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2079 (dps)
    08BA02176:
    C248_2155
    11819-97:
    MS7_2157 (dps1)
    71193:
    ST398NM01_2181
    ECT-R 2:
    ECTR2_1995
    ED133:
    SAOV_2179c
    ED98:
    SAAV_2194
    HO 5096 0412:
    SAEMRSA15_20470
    JH1:
    SaurJH1_2213
    JH9:
    SaurJH9_2175
    JKD6008:
    SAA6008_02178 (dps)
    JKD6159:
    SAA6159_02053 (dps)
    LGA251:
    SARLGA251_19400
    M013:
    M013TW_2099
    MRSA252:
    SAR2227
    MSHR1132:
    SAMSHR1132_19620
    MSSA476:
    SAS2042
    Mu3:
    SAHV_2123 (dps)
    Mu50:
    SAV2139 (dps)
    MW2:
    MW2063 (dps)
    RF122:
    SAB2023c
    ST398:
    SAPIG2181
    T0131:
    SAT0131_02304
    TCH60:
    HMPREF0772_11051 (dps)
    TW20:
    SATW20_22770
    USA300_TCH1516:
    USA300HOU_2128 (dps)
    VC40:
    SAVC_09570

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSNQQDVVKELNQQVANWTVAYTKLHNFHWYVKGPNFFSLHVKFEELYNEASQYVDELAE
    N315            MSNQQDVVKELNQQVANWTVAYTKLHNFHWYVKGPNFFSLHVKFEELYNEASQYVDELAE
    NCTC8325        MSNQQDVVKELNQQVANWTVAYTKLHNFHWYVKGPNFFSLHVKFEELYNEASQYVDELAE
    Newman          MSNQQDVVKELNQQVANWTVAYTKLHNFHWYVKGPNFFSLHVKFEELYNEASQYVDELAE
    USA300_FPR3757  MSNQQDVVKELNQQVANWTVAYTKLHNFHWYVKGPNFFSLHVKFEELYNEASQYVDELAE
                    ************************************************************

    COL             RILAVGGNPVGTLTECLEQSIVKEAAKGYSAEQMVEELSQDFTNISKQLENAIEIAGNAG
    N315            RILAVGGNPVGTLTECLEQSIVKEAAKGYSAEQMVEELSQDFTNISKQLENAIEIAGNAG
    NCTC8325        RILAVGGNPVGTLTECLEQSIVKEAAKGYSAEQMVEELSQDFTNISKQLENAIEIAGNAG
    Newman          RILAVGGNPVGTLTECLEQSIVKEAAKGYSAEQMVEELSQDFTNISKQLENAIEIAGNAG
    USA300_FPR3757  RILAVGGNPVGTLTECLEQSIVKEAAKGYSAEQMVEELSQDFTNISKQLENAIEIAGNAG
                    ************************************************************

    COL             DDVSEDMFIGMQTSVDKHNWMFKSYLS
    N315            DDVSEDMFIGMQTSVDKHNWMFKSYLS
    NCTC8325        DDVSEDMFIGMQTSVDKHNWMFKSYLS
    Newman          DDVSEDMFIGMQTSVDKHNWMFKSYLS
    USA300_FPR3757  DDVSEDMFIGMQTSVDKHNWMFKSYLS
                    ***************************