From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005439000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 5598933..5599079
  • synteny block?: BlockID0042340
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2082
    08BA02176:
    11819-97:
    MS7_2160
    71193:
    ST398NM01_2184
    ECT-R 2:
    ECTR2_1998
    ED133:
    ED98:
    SAAV_2197
    HO 5096 0412:
    SAEMRSA15_20500
    JH1:
    SaurJH1_2216
    JH9:
    SaurJH9_2178
    JKD6008:
    SAA6008_02181
    JKD6159:
    SAA6159_02056
    LGA251:
    SARLGA251_19430
    M013:
    M013TW_2102
    MRSA252:
    SAR2230
    MSHR1132:
    SAMSHR1132_19650
    MSSA476:
    SAS2045
    Mu3:
    SAHV_2126
    Mu50:
    SAV2142
    MW2:
    MW2066
    RF122:
    SAB2026c
    ST398:
    SAPIG2184
    T0131:
    SAT0131_02307
    TCH60:
    HMPREF0772_11048
    TW20:
    SATW20_22800
    USA300_TCH1516:
    USA300HOU_2131
    VC40:
    SAVC_09585

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKQFLYIALVCGVIAGLGAFLHIPQYPSMTIPRIVAILGIISAMLTFKDKQISASLKFSA
    N315            MKQFLYIALVCGVIAGLGAFLHIPQYPSMTIPRIVAILGIISAMLTFKDKQISASLKFSA
    NCTC8325        MKQFLYIALVCGVIAGLGAFLHIPQYPSMTIPRIVAILGIISAMLTFKDKQISASLKFSA
    Newman          MKQFLYIALVCGVIAGLGAFLHIPQYPSMTIPRIVAILGIISAMLTFKDKQISASLKFSA
    USA300_FPR3757  MKQFLYIALVCGVIAGLGAFLHIPQYPSMTIPRIVAILGIISAMLTFKDKQISASLKFSA
                    ************************************************************

    COL             LLINVLPLCGTFVASN
    N315            LLINVLPLCGTFVASN
    NCTC8325        LLINVLPLCGTFVASN
    Newman          LLINVLPLCGTFVASN
    USA300_FPR3757  LLINVLPLCGTFVASN
                    ****************