From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005442000
  • symbol?:
  • description?: oxidoreductase ylbE

      descriptions from strain specific annotations:

    • oxidoreductase ylbE
    • NAD dependent epimerase/dehydratase family protein
    • Nucleoside-diphosphate-sugar epimerase
    • putative NAD dependent epimerase
    • conserved protein YhfK
    • NAD-dependent dehydrogenase
  • strand?: -
  • coordinates?: 5600593..5601258
  • synteny block?: BlockID0042370
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2084 (ylbE)
    08BA02176:
    C248_2159
    11819-97:
    MS7_2162
    71193:
    ST398NM01_2186
    ECT-R 2:
    ECTR2_2000
    ED133:
    SAOV_2183c
    ED98:
    SAAV_2199
    HO 5096 0412:
    SAEMRSA15_20520
    JH1:
    SaurJH1_2218
    JH9:
    SaurJH9_2180
    JKD6008:
    SAA6008_02183
    JKD6159:
    SAA6159_02058
    LGA251:
    SARLGA251_19450
    M013:
    M013TW_2104
    MRSA252:
    SAR2232
    MSHR1132:
    SAMSHR1132_19670
    MSSA476:
    SAS2047
    Mu3:
    SAHV_2128
    Mu50:
    SAV2144
    MW2:
    MW2068
    RF122:
    SAB2028c
    ST398:
    SAPIG2186
    T0131:
    SAT0131_02309 (murE)
    TCH60:
    HMPREF0772_11046
    TW20:
    SATW20_22820
    USA300_TCH1516:
    USA300HOU_2133
    VC40:
    SAVC_09600

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNILVIGANGGVGSLLVQQLAKENVPFTAGVRQSDQLNALKSQGMKAILVDVENDSIETL
    N315            MNILVIGANGGVGSLLVQQLAKENVPFTAGVRQSDQLNALKSQGMKAILVDVENDSIETL
    NCTC8325        MNILVIGANGGVGSLLVQQLAKENVPFTAGVRQSDQLNALKSQGMKAILVDVENDSIETL
    Newman          MNILVIGANGGVGSLLVQQLAKENVPFTAGVRQSDQLNALKSQGMKAILVDVENDSIETL
    USA300_FPR3757  MNILVIGANGGVGSLLVQQLAKENVPFTAGVRQSDQLNALKSQGMKAILVDVENDSIETL
                    ************************************************************

    COL             TETFKPFDKVIFSVGSGGNTGADKTIIVDLDGAVKSMIASKEANIKHYVMVSTYDSRRQA
    N315            TETFKPFDKVIFSVGSGGNTGADKTIIVDLDGAVKSMIASKEANIKHYVMVSTYDSRRQA
    NCTC8325        TETFKPFDKVIFSVGSGGNTGADKTIIVDLDGAVKSMIASKEANIKHYVMVSTYDSRRQA
    Newman          TETFKPFDKVIFSVGSGGNTGADKTIIVDLDGAVKSMIASKEANIKHYVMVSTYDSRRQA
    USA300_FPR3757  TETFKPFDKVIFSVGSGGNTGADKTIIVDLDGAVKSMIASKEANIKHYVMVSTYDSRRQA
                    ************************************************************

    COL             FDDSGDLKPYTIAKHYADDYLRRSGLNYTILHPGALTNAAGSGKIEAAQYFDGKGEIPRE
    N315            FDDSGDLKPYTIAKHYADDYLRRSGLNYTILHPGALTNAAGSGKIEAAQYFDGKGEIPRE
    NCTC8325        FDDSGDLKPYTIAKHYADDYLRRSGLNYTILHPGALTNAAGSGKIEAAQYFDGKGEIPRE
    Newman          FDDSGDLKPYTIAKHYADDYLRRSGLNYTILHPGALTNAAGSGKIEAAQYFDGKGEIPRE
    USA300_FPR3757  FDDSGDLKPYTIAKHYADDYLRRSGLNYTILHPGALTNAAGSGKIEAAQYFDGKGEIPRE
                    ************************************************************

    COL             DVATVLKEIVTSNHFNHQEFQIISGDQDIKDALTQFENETD
    N315            DVATVLKEIVTSNHFNHQEFQIISGEQDIKDALTQFEIEKD
    NCTC8325        DVATVLKEIVTSNHFNHQEFQIISGDQDIKDALTQFENETD
    Newman          DVATVLKEIVTSNHFNHQEFQIISGDQDIKDALTQFENETD
    USA300_FPR3757  DVATVLKEIVTSNHFNHQEFQIISGDQDIKDALTQFENETD
                    *************************:*********** *.*