From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005471000
  • symbol?:
  • description?: cof family hydrolase

      descriptions from strain specific annotations:

    • cof family hydrolase
    • Hydrolase (HAD superfamily)
    • cof-like hydrolase family protein
    • haloacid dehalogenase
    • haloacid dehalogenase-like hydrolase
    • HAD family phosphatase
    • HAD hydrolase
    • HAD superfamily hydrolase
  • strand?: -
  • coordinates?: 5619535..5620392
  • synteny block?: BlockID0042600
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2091
    08BA02176:
    C248_2167
    11819-97:
    MS7_2168
    71193:
    ST398NM01_2192
    ECT-R 2:
    ECTR2_2006
    ED133:
    SAOV_2189c
    ED98:
    SAAV_2206
    HO 5096 0412:
    SAEMRSA15_20590
    JH1:
    SaurJH1_2223
    JH9:
    SaurJH9_2185
    JKD6008:
    SAA6008_02189
    JKD6159:
    SAA6159_02062
    LGA251:
    SARLGA251_19490
    M013:
    M013TW_2111
    MRSA252:
    SAR2240
    MSHR1132:
    SAMSHR1132_19710
    MSSA476:
    SAS2053
    Mu3:
    SAHV_2136
    Mu50:
    SAV2152
    MW2:
    MW2078
    RF122:
    SAB2032c
    ST398:
    SAPIG2192
    T0131:
    SAT0131_02316 (htrA)
    TCH60:
    HMPREF0772_11041
    TW20:
    SATW20_22880
    USA300_TCH1516:
    USA300HOU_2143
    VC40:
    SAVC_09630

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEGNIDNVKAIFLDMDGTILHENNQASTYTKDVINQLREKGYKVFLATGRSHSEIHQLVP
    N315            ----MDNVKAIFLDMDGTILHENNQASTYTKDVINQLREKGYKVFLATGRSHSEIHQLVP
    NCTC8325        ----MDNVKAIFLDMDGTILHENNQASTYTKDVINQLREKGYKVFLATGRSHSEIHQLVP
    Newman          ----MDNVKAIFLDMDGTILHENNQASTYTKDVINQLREKGYKVFLATGRSHSEIHQLVP
    USA300_FPR3757  ----MDNVKAIFLDMDGTILHENNQASTYTKDVINQLREKGYKVFLATGRSHSEIHQLVP
                        :*******************************************************

    COL             QDFAVNGIISSNGTIGEVDGEIIFKHGLSLAQVQQITNLAKRQQIYYEVFPFEGNRVSLK
    N315            QDFAVNGIISSNGTIGEVDGEIIFKHGLSLAQVQQITNLAKRQQIYYEVFPFEGNRVSLK
    NCTC8325        QDFAVNGIISSNGTIGEVDGEIIFKHGLSLAQVQQITNLAKRQQIYYEVFPFEGNRVSLK
    Newman          QDFAVNGIISSNGTIGEVDGEIIFKHGLSLAQVQQITNLAKRQQIYYEVFPFEGNRVSLK
    USA300_FPR3757  QDFAVNGIISSNGTIGEVDGEIIFKHGLSLAQVQQITNLAKRQQIYYEVFPFEGNRVSLK
                    ************************************************************

    COL             EDETWMRDMIRSQDPINGVSHSEWSSRQDALAGKIDWVTKFPEGEYSKIYLFSSNLEKIT
    N315            EDETWMRDMIRSQDPINGVSHSEWSSRQDALAGKIDWVTKFPEGEYSKIYLFSSNLEKIT
    NCTC8325        EDETWMRDMIRSQDPINGVSHSEWSSRQDALAGKIDWVTKFPEGEYSKIYLFSSNLEKIT
    Newman          EDETWMRDMIRSQDPINGVSHSEWSSRQDALAGKIDWVTKFPEGEYSKIYLFSSNLEKIT
    USA300_FPR3757  EDETWMRDMIRSQDPINGVSHSEWSSRQDALAGKIDWVTKFPEGEYSKIYLFSSNLEKIT
                    ************************************************************

    COL             AFRYELKQNHVQLQISVSNSSRFNAETMAYQTDKGTGIKEMIAHFGIHQEETLVIGDSDN
    N315            AFRDELKQNHVQLQISVSNSSRFNAETMAYQTDKGTGIKEMIAHFGIHQEETLVIGDSDN
    NCTC8325        AFRDELKQNHVQLQISVSNSSRFNAETMAYQTDKGTGIKEMIAHFGIHQEETLVIGDSDN
    Newman          AFRDELKQNHVQLQISVSNSSRFNAETMAYQTDKGTGIKEMIAHFGIHQEETLVIGDSDN
    USA300_FPR3757  AFRDELKQNHVQLQISVSNSSRFNAETMAYQTDKGTGIKEMIAHFGIHQEETLVIGDSDN
                    *** ********************************************************

    COL             DRAMFEFGHYTVAMKNARPEIQALTSDVTAYTNEEDGAAKYLAEHFLAE
    N315            DRAMFEFGHYTVAMKNARPEIQALTSDVTAYTNEEDGAAKYLAKHFLAD
    NCTC8325        DRAMFEFGHYTVAMKNARPEIQALTSDVTAYTNEEDGAAKYLAEHFLAE
    Newman          DRAMFEFGHYTVAMKNARPEIQALTSDVTAYTNEEDGAAKYLAEHFLAE
    USA300_FPR3757  DRAMFEFGHYTVAMKNARPEIQALTSDVTAYTNEEDGAAKYLAEHFLAE
                    *******************************************:****: