From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005501000
  • symbol?: fmtB
  • description?: methicillin resistance determinant FmtB protein

      descriptions from strain specific annotations:

    • methicillin resistance determinant FmtB protein
    • fmtB protiein
    • truncated FmtB protein
    • LPXTG surface-anchored protein
    • SasB protein
    • pseudogene
    • cell wall anchor domain-containing protein
    • FmtB (Mrp) protein involved in methicillin resistance and cell wall biosynthesis
    • truncated methicillin resistance-related surface protein
  • strand?: -
  • coordinates?: 5656725..5662128
  • synteny block?: BlockID0042830
  • occurrence?: in 66% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2150 (fmtB)
    N315:
    SA1964 (fmtB)
    NCTC8325:
    Newman:
    NWMN_2061 (fmtB)
    USA300_FPR3757:
    04-02981:
    SA2981_2099 (fmtB)
    08BA02176:
    11819-97:
    MS7_2175
    71193:
    ECT-R 2:
    ECTR2_2013
    ED133:
    ED98:
    SAAV_2214 (fmtB)
    HO 5096 0412:
    JH1:
    SaurJH1_2230
    JH9:
    SaurJH9_2192
    JKD6008:
    SAA6008_02197
    JKD6159:
    SAA6159_02069
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_2144 (fmtB)
    Mu50:
    SAV2160 (fmtB(mrp))
    MW2:
    MW2086 (fmtB)
    RF122:
    SAB2040c (fmtB)
    ST398:
    T0131:
    SAT0131_02325 (comK)
    TCH60:
    TW20:
    SATW20_22950 (fmtB)
    USA300_TCH1516:
    USA300HOU_2150 (fmtB2)
    VC40:
    SAVC_09665

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNLFRQQKFSIRKFNVGIFSALIATVTFISTNPTTASAAEQNQPAQNQPAQPADANTQPN
    N315            MNLFRQQKFSIRKFNVGIFSALIATVTFISTNPTTASAAEQNQPAQNQPAQPADANTQPN
    NCTC8325        MNLFRQQKFSIRKFNVGIFSALIATVTFISTNPTTASAAEQNQPAQNQPAQPADANTQPN
    Newman          MNLFRQQKFSIRKFNVGIFSALIATVTFISTNPTTASAAEQNQPAQNQPAQPADANTQPN
    USA300_FPR3757  ------------------------------------------------------------
                                                                                

    COL             ANAGAQANPTAQPAAPANQGQPAVQPANQGGQANPAGGAAQPNTQPAGQGNQADPNNAAQ
    N315            ANAGAQAN-------------PAAQPANQGGQANPAGGAA----QPAGQGNQADPNNAAQ
    NCTC8325        ANAGAQANPTAQPAAPANQGQPAVQPANQGGQANPAGGAAQPNTQPAGQGDQADPNNAAQ
    Newman          ANAGAQANPTAQPAAPANQGQPAVQPANQGGQANPAGGAAQPNTQPAGQGNQADPNNAAQ
    USA300_FPR3757  ------------------------------------------------------------
                                                                                

    COL             AQPGNQATPANQAGQGNNQATPNNNATPANQTQPANAPAAAQPAAPVAANAQTQDPNASN
    N315            AQPGNQAAPANQAGQGNNQATPNNNATPANQTQPANAPAAAQPAAPVAANAQTQDPNASN
    NCTC8325        AQPGNQATPANQAGQGNNQATPNNNATPANQTQPANAPAAAQPAAPVAANAQTQDPNASN
    Newman          AQPGNQATPANQAGQGNNQATPNNNATPANQTQPANAPAAAQPAAPVAANAQTQDPNASN
    USA300_FPR3757  ------------------------------------------------------------
                                                                                

    COL             TGEGSINTTLTFDDPAISTDENRQDPTVTVTDKVNGYSLINNGKIGFVNSELRRSDMFDK
    N315            TGEGSINTTLTFDDPAISTDENRQDPTVTVTDKVNGYSLINNGKIGFVNSELRRSDMFDK
    NCTC8325        TGEGSINTTLTFDDPAISTDENRQDPTVTVTDKVNGYSLINNGKIGFVNSELRRSDMFDK
    Newman          TGEGSINTTLTFDDPAISTDENRQDPTVTVTDKVNGYSLINNGKIGFVNSELRRSDMFDK
    USA300_FPR3757  ------------------------------------------------------------
                                                                                

    COL             NNPQNYQAKGNVAALGRVNANDSTDHGNFNGISKTVNVKPDSELIINFTTMQTNSKQGAT
    N315            NNPQNYQAKGNVAALGRVNANDSTDHGNFNGITKTVNVKPDSELIINFTTMQTNSKQGAT
    NCTC8325        NNPQNYQAKGNVAALGRVNANDSTDHGNFNGISKTVNVKPDSELIINFTTMQTNSKQGAT
    Newman          NNPQNYQAKGNVAALGRVNANDSTDHGNFNGISKTVNVKPDSELIINFTTMQTNSKQGAT
    USA300_FPR3757  ------------------------------------------------------------
                                                                                

    COL             NLVIKDAKKNTELATVNVAKTGTAHLFKVPTDADRLDLQFIPDNTAVADASRITTNKDGY
    N315            NLVIKDAKKNTELATVNVAKTGTAHLFKVPTDADRLDLQFIPDNTAVADASRITTNKDGY
    NCTC8325        NLVIKDAKKNTELATVNVAKTGTAHLFKVPTDADRLDLQFIPDNTAVADASRITTNKDGY
    Newman          NLVIKDAKKNTELATVNVAKTGTAHLFKVPTDADRLDLQFIPDNTAVADASRITTNKDGY
    USA300_FPR3757  ------------------------------------------------------------
                                                                                

    COL             KYYSFIDNVGLFSGSHLYVKNRDLAPKATNNKEYTINTEIGNNGNFGASLKADQFKYEVT
    N315            KYYSFIDNVGLFSGSHLYVKNRDLAPKATNNKEYTINTEIGNNGNFGASLKADQFKYEVT
    NCTC8325        KYYSFIDNVGLFSGSHLYVKNRDLAPKATNNKEYTINTEIGNNGNFGASLKADQFKYEVT
    Newman          KYYSFIDNVGLFSGSHLYVKNRDLAPKATNNKEYTINTEIGNNGNFGASLKADQFKYEVT
    USA300_FPR3757  ------------------------------------------------------------
                                                                                

    COL             LPQGVTYVNNSLTTTFPNGNEDSTVLKNMTVNYDQNANKVTFTSQGVTTARGTHTKEVLF
    N315            LPQGVTYVNDSLTTTFPNGNEDSTVLKNMTVNYDQTANKVTFTSQGVTTARGTHTKEVLF
    NCTC8325        LPQGVTYVNNSLTTTFPNGNEDSTVLKNMTVNYDQNANKVTFTSQGVTTARGTHTKEVLF
    Newman          LPQGVTYVNNSLTTTFPNGNEDSTVLKNMTVNYDQNANKVTFTSQGVTTARGTHTKEVLF
    USA300_FPR3757  ------------------------------------------------------------
                                                                                

    COL             PDKSLKLSYKVNVANIDTPKNIDFNEKLTYRTASDVVINNAQPEVTLTADPFSVAVEMNK
    N315            PDKSLKLSYKVNVANIDTPKNIDFNEKLTYRTASDVVINNAQPEVTLTADPFSVAVEMNK
    NCTC8325        PDKSLKLSYKVNVANIDTPKNIDFNEKLTYRTASDVVINNAQPEVTLTADPFSVAVEMNK
    Newman          PDKSLKLSYKVNVANIDTPKNIDFNEKLTYRTASDVVINNAQPEVTLTADPFSVAVEMNK
    USA300_FPR3757  ------------------------------------------------------------
                                                                                

    COL             DALQQQVNSQVDNSHYTTASIAEYNKLKQQADTILNEDANHVKTANRASQADIDGLVTKL
    N315            DALQQQVNSQVDNSHYTTASIAEYNKLKQQADTILNEDANHVETANRASQADIDGLVTKL
    NCTC8325        DALQQQVNSQVDNSHYTTASIAEYNKLKQQADTILNEDANHVKTANRASQADIDGLVTKL
    Newman          DALQQQVNSQVDNSHYTTASIAEYNKLKQQADTILNEDANHVKTANRASQADIDGLVTKL
    USA300_FPR3757  ------------------------------------------------------------
                                                                                

    COL             QAALIDNQAAIAELDTKAQEKVTAAQQSKKVTQDEVAALVTKINNDKNNAIAEINKQTTA
    N315            QAALIDNQAAIAELDTKAQEKVTAAQQSKKVTQDEVAALVTKINNDKNNAIAEINKQTTS
    NCTC8325        QAALIDNQAAIAELDTKAQEKVTAAQQSKKVTQDEVAALVTKINNDKNNAIAEINKQTTA
    Newman          QAALIDNQAAIAELDTKAQEKVTAAQQSKKVTQDEVAALVTKINNDKNNAIAEINKQTTA
    USA300_FPR3757  ------------------------------------------------------------
                                                                                

    COL             QGVTTEKDNGIAVLEQDVITPTVKPQAKQDIIQAVTTRKQQIKKSNASLQDEKDVANDKI
    N315            QGVTTEKDNGIAVLEQDVITPTVKPQAKQDIIQAVTTRKQQIKKSNASLQDEKDVANDKI
    NCTC8325        QGVTTEKDNGIAVLEQDVITPTVKPQAKQDIIQAVTTRKQQIKKSNASLQDEKDVANDKI
    Newman          QGVTTEKDNGIAVLEQDVITPTVKPQAKQDIIQAVTTRKQQIKKSNASLQDEKDVANDKI
    USA300_FPR3757  ------------------------------------------------------------
                                                                                

    COL             GKIETKAIKDIDAATTNAQVEAIKTKAINDINQTTPATTAKAAALEEFDEVVQAQIDQAP
    N315            GKIETKAIKDIDAATTNAQVEAIKTKAINDINQTTPATTAKAAALEEFDEVVQAQIDQAP
    NCTC8325        GKIETKAIKDIDAATTNAQVEAIKTKAINDINQTTPATTAKAAALEEFDEVVQAQIDQAP
    Newman          GKIETKAIKDIDAATTNAQVEAIKTKAINDINQTTPATTAKAAALEEFDEVVQAQIDQAP
    USA300_FPR3757  ------------------------------------------------------------
                                                                                

    COL             LNPDTTNEEVAEAIERINAAKVSGVKAIEATTTAQDLERVKNEEISKIENITDSTQTKMD
    N315            LNPDTTNEEVAEAIERINAAKVSGVKAIEATTTAQDLERVKNEEIFKIENITDSTQTKMD
    NCTC8325        LNPDTTNEEVAEAIERINAAKVSGVKAIEATTTAQDLERVKNEEISKIENITDSTQTKMD
    Newman          LNPDTTNEEVAEAIERINAAKVSGVKAIEATTTAQDLERVKNEEISKIENITDSTQTKMD
    USA300_FPR3757  ------------------------------------------------------------
                                                                                

    COL             AYNEVKQAATARKAQNATVSNATNEEVAEADAAVDAAQKQGLHDIQVVKSKQEVADTKSK
    N315            AYKEVRQAATARKAQNATVSNATDEEVAEANAAVDAAQTEGLHDIQVVKSQQEVADTKAK
    NCTC8325        AYNEVKQAATARKAQNATVSNATNEEVAEADAAVDAAQKQGLHDIQVVKSKQEVADTKSK
    Newman          AYNEVKQAATARKAQNATVSNATNEEVAEADAAVDAAQKQGLHDIQVVKSKQEVADTKSK
    USA300_FPR3757  ------------------------------------------------------------
                                                                                

    COL             VLDKINAIQTQAKVKPAADTEVENAYNTRKQEIQNSNASTTEEKQAAYTELDTKKQEART
    N315            VLDKINAIQTQAKVKPAADTEVENAYNTRKQEIQNSNASTTEEKEAAYTELDAKKQEART
    NCTC8325        VLDKINAIQTQAKVKPAADTEVENAYNTRKQEIQNSNASTTEEKQAAYTELDTKKQEART
    Newman          VLDKINAIQTQAKVKPAADTEVENAYNTRKQEIQNSNASTTEEKQAAYTELDTKKQEART
    USA300_FPR3757  ------------------------------------------------------------
                                                                                

    COL             NLDAANTNSDVTTAKDNSIAAINQVQAATTKKSDAKAEIAQKASERKTAIEAMNDSTTEE
    N315            NLDAANTNSDVTTAKDNGIAAINQVQAATTKKSDAKAEIAQKASERKTAIEAMNDSTTEE
    NCTC8325        NLDAANTNSDVTTAKDNSIAAINQVQAATTKKSDAKAEIAQKASERKTAIEAMNDSTTEE
    Newman          NLDAANTNSDVTTAKDNSIAAINQVQAATTKKSDAKAEIAQKASERKTAIEAMNDSTTEE
    USA300_FPR3757  ------------------------------------------------------------
                                                                                

    COL             QQAAKDKVDQAVVTANADIDNAAANNDVDNAKTTNEATIAAITPDANVKPAAKQAIADKV
    N315            QQAAKDKVDQAVVTANADIDNATANTDVDNAKTTNEATIAAITPDANVKPAAKQAIADKV
    NCTC8325        QQAAKDKVDQAVVTANADIDNAAANNDVDNAKTTNEATIAAITPDANVKPAAKQAIADKV
    Newman          QQAAKDKVDQAVVTANADIDNAAANNDVDNAKTTNEATIAAITPDANVKPAAKQAIADKV
    USA300_FPR3757  ------------------------------------------------------------
                                                                                

    COL             QAQETAIDGNNGSTTEEKAAAKQQVQTEKTTADAAIDAAHTNAEVEAAKKAAIAKIEAIQ
    N315            QAQETAIDANNGSTTEEKEAAKQQVQTEKTAADAAIDAAHSNVEVEAAKNAEIAKIEAIQ
    NCTC8325        QAQETAIDGNNGSTTEEKAAAKQQVQTEKTTADAAIDAAHTNAEVEAAKKAAIAKIEAIQ
    Newman          QAQETAIDGNNGSTTEEKAAAKQQVQTEKTTADAAIDAAHTNAEVEAAKKAAIAKIEAIQ
    USA300_FPR3757  ------------------------------------------------------------
                                                                                

    COL             PATTTKDNAKEAIATKANERKTAIAQTQDITAEEIAAANADVDNAVTQANSNIEAANSQN
    N315            PATTTKDNAKQAIATKANERKTAIAQTQDITAEEIAAANADVDNAVTQANSNIEAANSQN
    NCTC8325        PATTTKDNAKEAIATKANERKTAIAQTQDITAEEIAAANADVDNAVTQANSNIEAANSQN
    Newman          PATTTKDNAKEAIATKANERKTAIAQTQDITAEEIAAANADVDNAVTQANSNIEAANSQN
    USA300_FPR3757  ---------------------------------------------MTQANSNIEAANSQN
                                                                 :**************

    COL             DVDQAKTTGENSIDQVTPTVNKKATARNEITAILNNKLQEIQATPDATDEEKQAADAEAN
    N315            DVDQAKTTGETSIDQVTPTVNKKATARNEITAILNNKLQEIQATPDATDEEKQAADAEAN
    NCTC8325        DVDQAKTTGENSIDQVTPTVNKKATARNEITAILNNKLQEIQATPDATDEEKQAADAEAN
    Newman          DVDQAKTTGENSIDQVTPTVNKKATARNEITAILNNKLQEIQATPDATDEEKQAADAEAN
    USA300_FPR3757  DVDQAKTTGENSIDQVTPTVNKKATARNEITAILNNKLQEIQATPDATDEEKQAADAEAN
                    **********.*************************************************

    COL             TENGKANQAISAATTNAQVDEAKANAEAAINAVTPKVVKKQAAKDEIDQLQATQTNVINN
    N315            TENGKANQAISAATTNAQVDEAKANAEAAINAVTPKVVKKQAAKDEIDQLQATQTNVINN
    NCTC8325        TENGKANQAISAATTNAQVDEAKANAEAAINAVTPKVVKKQAAKDEIDQLQATQTNVINN
    Newman          TENGKANQAISAATTNAQVDEAKANAEAAINAVTPKVVKKQAAKDEIDQLQATQTNVINN
    USA300_FPR3757  TENGKANQAISAATTNAQVDEAKANAEAAINAVTPKVVKKQAAKDEIDQLQATQTNVINN
                    ************************************************************

    COL             DQNATTEEKEAAIQQLATAVTDAKNNITAATDDNGVDQAKDAGKNSIQSTQPATAVKSNA
    N315            DQNATNEEKEAAIQQLATAVTDAKNNITAATDDNGVDTAKDAGKNSIQSTQPATAVKSNA
    NCTC8325        DQNATTEEKEAAIQQLATAVTDAKNNITAATDDNGVDQAKDAGKNSIQSTQPATAVKSNA
    Newman          DQNATTEEKEAAIQQLATAVTDAKNNITAATDDNGVDQAKDAGKNSIQSTQPATAVKSNA
    USA300_FPR3757  DQNATTEEKEAAIQQLATAVTDAKNNITAATDDNGVDQAKDAGKNSIQSTQPATAVKSNA
                    *****.******************************* **********************

    COL             KNDVDQAVTTQNQAIDNTTGATTEEKNAAKDLVLKAKEKAYQDILNAQTTNDVTQIKDQA
    N315            KNEVDQAVTTQNQAIDNTTGATTEEKNAAKDLVLKAKEKAYQDILNAQTTNDVTQIKDQA
    NCTC8325        KNDVDQAVTTQNQAIDNTTGATTEEKNAAKDLVLKAKEKAYQDILNAQTTNDVTQIKDQA
    Newman          KNDVDQAVTTQNQAIDNTTGATTEEKNAAKDLVLKAKEKAYQDILNAQTTNDVTQIKDQA
    USA300_FPR3757  KNDVDQAVTTQNQAIDNTTGATTEEKNAAKDLVLKAKEKAYQDILNAQTTNDVTQIKDQA
                    **:*********************************************************

    COL             VADIQGITADTTIKDVAKDELATKANEQKALIAQTADATTEEKEQANQQVDAQLTQGNQN
    N315            VADIQGITADTTIKDVAKDELATKANEQKALIAQTADATTEEKEQANQQVDAQLTQGNQN
    NCTC8325        VADIQGITADTTIKDVAKDELATKANEQKALIAQTADATTEEKEQANQQVDAQLTQGNQN
    Newman          VADIQGITADTTIKDVAKDELATKANEQKALIAQTADATTEEKEQANQQVDAQLTQGNQN
    USA300_FPR3757  VADIQGITADTTIKDVAKDELATKANEQKALIAQTADATTEEKEQANQQVDAQLTQGNQN
                    ************************************************************

    COL             IENAQSIDDVNTAKDNAIQAIDPIQASTDVKTNARAELLTEMQNKITEILNNNETTNEEK
    N315            IENAQSIDDVNTAKDNAIQAIDPIQASTDVKTNARAELLTEMQNKITEILNNNETTNEEK
    NCTC8325        IENAQSIDDVNTAKDNAIQAIDPIQASTDVKTNARAELLTEMQNKITEILNNNETTNEEK
    Newman          IENAQSIDDVNTAKDNAIQAIDPIQASTDVKTNARAELLTEMQNKITEILNNNETTNEEK
    USA300_FPR3757  IENAQSIDDVNTAKDNAIQAIDPIQASTDVKTNARAELLTEMQNKITEILNNNETTNEEK
                    ************************************************************

    COL             GNDIGPVRAAYEEGLNNINAATTTGDVTTAKDTAVQKVQQLHANPVKKPAGKKELDQAAA
    N315            GNDIGPVRAAYEEGLNNINAATTTGDVTTAKDTAVQKVQQLHANPVKKPAGKKELDQAAA
    NCTC8325        GNDIGPVRAAYEEGLNNINAATTTGDVTTAKDTAVQKVQQLHANPVKKPAGKKELDQAAA
    Newman          GNDIGPVRAAYEEGLNNINAATTTGDVTTAKDTAVQKVQQLHANPVKKPAGKKELDQAAA
    USA300_FPR3757  GNDIGPVRAAYEEGLNNINAATTTGDVTTAKDTAVQKVQQLHANPVKKPAGKKELDQAAA
                    ************************************************************

    COL             DKKTQIEQTPNASQQEINDAKQEVDTELNQAKTNVDQSSTNEYVDNAVKEGKAKINAVKT
    N315            DKKTQIEQTPNASQQEINDAKQEVDTELNQAKTNVDQSSTNEYVDNAVKEGKAKINAVKT
    NCTC8325        DKKTQIEQTPNASQQEINDAKQEVDTELNQAKTNVDQSSTNEYVDNAVKEGKAKINAVKT
    Newman          DKKTQIEQTPNASQQEINDAKQEVDTELNQAKTNVDQSSTNEYVDNAVKEGKAKINAVKT
    USA300_FPR3757  DKKTQIEQTPNASQQEINDAKQEVDTELNQAKTNVDQSSTNEYVDNAVKEGKAKINAVKT
                    ************************************************************

    COL             FSEYKKDALAKIEDAYNAKVNEADNSNASTSSEIAEAKQKLAELKQTADQNVNQATSKDD
    N315            FSEYKKDALAKIEDAYNAKVNEADNSNASTSSEIAEAKQKLAELKQTADQNVNQATSKDD
    NCTC8325        FSEYKKDALAKIEDAYNAKVNEADNSNASTSSEIAEAKQKLAELKQTADQNVNQATSKDD
    Newman          FSEYKKDALAKIEDAYNAKVNEADNSNASTSSEIAEAKQKLAELKQTADQNVNQATSKDD
    USA300_FPR3757  FSEYKKDALAKIEDAYNAKVNEADNSNASTSSEIAEAKQKLAELKQTADQNVNQATSKDD
                    ************************************************************

    COL             IEVQIHNDLDNINDYTIPTGKKESATTDLYAYADQKKNNISADTNATQDEKQQAIKQVDQ
    N315            IEVQIHNDLDNINDYTIPTGKKESATTDLYAYADQKKNNISADTNATQDEKQQAIKQVDQ
    NCTC8325        IEVQIHNDLDNINDYTIPTGKKESATTDLYAYADQKKNNISADTNATQDEKQQAIKQVDQ
    Newman          IEVQIHNDLDNINDYTIPTGKKESATTDLYAYADQKKNNISADTNATQDEKQQAIKQVDQ
    USA300_FPR3757  IEVQIHNDLDNINDYTIPTGKKESATTDLYAYADQKKNNISADTNATQDEKQQAIKQVDQ
                    ************************************************************

    COL             NVQTALESINNGVDNGDVDDALTQGKAAIDAIQVDATVKPKANQAIEVKAEDTKESIDQS
    N315            NVQTALENINNGVDNGDVDDALTQGKAAIDTIQVDATVKPKANQAIEAKAEDTKESIDHS
    NCTC8325        NVQTALESINNGVDNGDVDDALTQGKAAIDAIQVDATVKPKANQAIEVKAEDTKESIDQS
    Newman          NVQTALESINNGVDNGDVDDALTQGKAAIDAIQVDATVKPKANQAIEVKAEDTKESIDQS
    USA300_FPR3757  NVQTALESINNGVDNGDVDDALTQGKAAIDAIQVDATVKPKANQAIEVKAEDTKESIDQS
                    *******.**********************:****************.**********:*

    COL             DQLTAEEKTEALAMIKQITDQAKQGITDATTTAEVEKAKAQGLEAFDNIQIDSTEKQKAI
    N315            DQLTAEEKTEALAMIKQITDQAKQGITDATTTAEVEKAKAQGLEAFDNIQIDSTEKQKAI
    NCTC8325        DQLTAEEKTEALAMIKQITDQAKQGITDATTTAEVEKAKAQGLEAFDNIQIDSTEKQKAI
    Newman          DQLTAEEKTEALAMIKQITDQAKQGITDATTTAEVEKAKAQGLEAFDNIQIDSTEKQKAI
    USA300_FPR3757  DQLTAEEKTEALAMIKQITDQAKQGITDATTTAEVEKAKAQGLEAFDNIQIDSTEKQKAI
                    ************************************************************

    COL             EELETALDQIEAGVNVNADATTEEKEAFTNALEDILSKATEDISDQTTNAEIATVKNSAL
    N315            EELETALDQIEAGVNVDADATTEEKEAFTNALEDILSKATEDISDQTTNAEIATVKNSAL
    NCTC8325        EELETALDQIEAGVNVNADATTEEKEAFTNALEDILSKATEDISDQTTNAEIATVKNSAL
    Newman          EELETALDQIEAGVNVNADATTEEKEAFTNALEDILSKATEDISDQTTNAEIATVKNSAL
    USA300_FPR3757  EELETALDQIEAGVNVNADATTEEKEAFTNALEDILSKATEDISDQTTNAEIATVKNSAL
                    ****************:*******************************************

    COL             EQLKAQRINPEVKKNALEAIREVVNKQIEIIKNADADASAKEIARTDLGRYFDRFADKLD
    N315            EQLKAQRINPVVKKNALEAIREVVNKQIEIIKNADADASAKEIARTDLGRYFDRFADKLD
    NCTC8325        EQLKAQRINPEVKKNALEAIREVVNKQIEIIKNADADASAKEIARTDLGRYFDRFADKLD
    Newman          EQLKAQRINPEVKKNALEAIREVVNKQIEIIKNADADASAKEIARTDLGRYFDRFADKLD
    USA300_FPR3757  EQLKAQRINPEVKKNALEAIREVVNKQIEIIKNADADASAKEIARTDLGRYFDRFADKLD
                    ********** *************************************************

    COL             KTQTNAEVAELQNVTIPAIEAIVPQNDPDANDTNNGIDNNDATANSNANATPENTGQPNV
    N315            KTQTNTEVAELQNVTIPAIEAIVPQNDPDANDTNNGTDNNDATANSNANATPENTGQPNV
    NCTC8325        KTQTNAEVAELQNVTIPAIEAIVPQNDPDANDTNNGIDNNDATANSNANATPENTGQPNV
    Newman          KTQTNAEVAELQNVTIPAIEAIVPQNDPDANDTNNGIDNNDATANSNANATPENTGQPNV
    USA300_FPR3757  KTQTNAEVAELQNVTIPAIEAIVPQNDPDANDTNNGIDNNDATANSNANATPENTGQPNV
                    *****:****************************** ***********************

    COL             SETTANGKADASPTTPNNSDAATGETTATSATDDANDKPQANNNSSVDASTNSPTMDNDV
    N315            SETTDNGKADASPTTPNNSDAATGETTVTSATDDAKDKPQANNNSSADASTNSPTMDNDV
    NCTC8325        SETTANGKADASPTTPNNSDAATGETTATSATDDANDKPQANNNSSVDASTNSPTMDNDV
    Newman          SETTANGKADASPTTPNNSDAATGETTATSATDDANDKPQANNNSSVDASTNSPTMDNDV
    USA300_FPR3757  SETTANGKADASPTTPNNSDAATGETTATSATDDANDKPQANNNSSVDASTNSPTMDNDV
                    **** **********************.*******:**********.*************

    COL             TSKPEVESTNNGTTDKPVTETDNATPAESTTNNNSTTTATNENAPTGSTATAPTTASTEA
    N315            TSKPEVESTNNGTTDKPVTETDNATPAESTTNNNSTTTATNENAPTGSTATAPTTASTEA
    NCTC8325        TSKPEVESTNNGTTDKPVTETDNATPAESTTNNNSTTTATNENAPTGSTATAPTTASTEA
    Newman          TSKPEVESTNNGTTDKPVTETDNATPAESTTNNNSTTTATNENAPTGSTATAPTTASTEA
    USA300_FPR3757  TSKPEVESTNNGTTDKPVTETDNATPAESTTNNNSTTTATNENAPTGSTATAPTTASTEA
                    ************************************************************

    COL             ASSADSKDNASVNDSKQNAEVNNSAESQSTNDKVAQPKSENKAKAEKDGSDSTNQSMVES
    N315            ASSADSKDNASVNDSKQNAEVNNSAESQSTNGKVAQPKSENKAKAEKDGRDSTNQSMVES
    NCTC8325        ASSADSKDNASVNDSKQNAEVNNSAESQSTNDKVAQPKSENKAKAEKDGSDSTNQSMVES
    Newman          ASSADSKDNASVNDSKQNAEVNNSAESQSTNDKVAQPKSENKAKAEKDGSDSTNQSMVES
    USA300_FPR3757  ASSADSKDNASVNDSKQNAEVNNSAESQSTNDKVAQPKSENKAKAEKDGSDSTNQSMVES
                    *******************************.***************** **********

    COL             TTETLPSADITEPNVPSNTSKDKEESTTNQTDAGQLKSETNVASNEADKSPSKADTEVSN
    N315            TTETLPSADITEPNVPSNTSKDKEESTTNQTDAGQLKSETNVASNEADKSPSKADTEVSN
    NCTC8325        TTETLPSADITEPNVPSNTSKDKEESTTNQTDAGQLKSETNVASNEADKSPSKADTEVSN
    Newman          TTETLPSADITEPNVPSNTSKDKEESTTNQTDAGQLKSETNVASNEADKSPSKADTEVSN
    USA300_FPR3757  TTETLPSADITEPNVPSNTSKDKEESTTNQTDAGQLKSETNVASNEADKSPSKADTEVSN
                    ************************************************************

    COL             KPSTSASSEAKEKMTSTNLSQKDDTATAD--------------------TNDTQKSVGSA
    N315            KPSTSASSEAKDKMTSTNVSQKDDTATADTNDTQKSVGPVANNKAKDMQTNDTQKSVGSA
    NCTC8325        KPSTSASSEAKEKMTSTNVSQKDDTATAD--------------------TNDTQKSVGSA
    Newman          KPSTSASSEAKEKMTSTNLSQKDDTATAD--------------------TNDTQKSVGSA
    USA300_FPR3757  KPSTSASSEAKEKMTSTNVSQKDDTATAD--------------------TNDTQKSVGSA
                    ***********:******:**********                    ***********

    COL             ANNKATQNDGANASPATVSNGSNSANQDMLNVTNTDDHQAKTKSAQQGKVNKAKQQAKTL
    N315            ANNKATQNDGANASPATVSNGSHSMHQDMLNVTKPEENKANAKSDQQGKVNKPKQQAKTL
    NCTC8325        ANNKATQNDGANASPATVSNGSNSANQDMLNVTNTDDHQAKTKSAQQGKVNKAKQQAKTL
    Newman          ANNKATQNDGANASPATVSNGSNSANQDMLNVTNTDDHQAKTKSAQQGKVNKAKQQAKTL
    USA300_FPR3757  ANNKATQNDGANASPATVSNGSNSANQDMLNVTNTDDHQAKTKSAQQGKVNKAKQQAKTL
                    **********************:* :*******:.::::*::** *******.*******

    COL             PDTGMSHNDDLPYAELALGAGMAFLIRRFTKKDQQTEE
    N315            PDTGMSHNDDLPYAELALGAGMAFLIRRFTKKDQQTEE
    NCTC8325        PDTGMSHNDDLPYAELALGAGMAFLIRRFTKKDQQTEE
    Newman          PDTGMSHNDDLPYAELALGAGMAFLIRRFTKKDQQTEE
    USA300_FPR3757  PDTGMSHNDDLPYAELALGAGMAFLIRRFTKKDQQTEE
                    **************************************