From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005554000
  • symbol?: lmrS
  • description?: MFS transporter

      descriptions from strain specific annotations:

    • MFS transporter
    • EmrB/QacA family drug resistance transporter
    • drug resistance transporter EmrB/QacA subfamily protein
    • drug resistance MFS transporter, drug:H+ antiporter-1 (14 Spanner) (DHA2) family protein
    • Drug resistance transporter, EmrB/QacA subfamily
    • EmrB/QacA subfamily drug resistance transporter
    • H+ antiporter-2 family protein
    • lincomycin resistance protein LmrB
    • major facilitator transporter
    • multidrug resistance protein
    • multidrug resistance protein B
    • multidrug resistance transporter
    • pseudogene
    • putative transport protein
    • transport protein
  • strand?: -
  • coordinates?: 5697024..5698419
  • synteny block?: BlockID0043150
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2105
    08BA02176:
    C248_2203
    11819-97:
    MS7_2190
    71193:
    ST398NM01_2227
    ECT-R 2:
    ECTR2_2028
    ED133:
    SAOV_2214c
    ED98:
    SAAV_2228
    HO 5096 0412:
    SAEMRSA15_20720
    JH1:
    SaurJH1_2236
    JH9:
    SaurJH9_2198
    JKD6008:
    SAA6008_02205
    JKD6159:
    SAA6159_02078
    LGA251:
    SARLGA251_19620
    M013:
    M013TW_2133
    MRSA252:
    SAR2257
    MSHR1132:
    SAMSHR1132_19990
    MSSA476:
    SAS2068
    Mu3:
    SAHV_2150
    Mu50:
    SAV2166
    MW2:
    MW2093
    RF122:
    SAB2048c
    ST398:
    SAPIG2227
    T0131:
    SAT0131_02335
    TCH60:
    HMPREF0772_11025 (lmrB3)
    TW20:
    SATW20_23020
    USA300_TCH1516:
    USA300HOU_2158
    VC40:
    SAVC_09705

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKVELTTRRRNFIVAVMLISAFVAILNQTLLNTALPSIMRELNINESTSQWLVTGFMLV
    N315            MAKVELTTRRRNFIVAVMLISAFVAILNQTLLNTALPSIMRELNINESTSQWLVTGFMLV
    NCTC8325        MAKVELTTRRRNFIVAVMLISAFVAILNQTLLNTALPSIMRELNINESTSQWLVTGFMLV
    Newman          MAKVELTTRRRNFIVAVMLISAFVAILNQTLLNTALPSIMRELNINESTSQWLVTGFMLV
    USA300_FPR3757  MAKVELTTRRRNFIVAVMLISAFVAILNQTLLNTALPSIMRELNINESTSQWLVTGFMLV
                    ************************************************************

    COL             NGVMIPLTAYLMDRIKTRPLYLAAMGTFLLGSIVAALAPNFGVLMLARVIQAMGAGVLMP
    N315            NGVMIPLTAYLMDRIKTRPLYLAAMGTFLLGSIVAALAPNFGVLMLARVIQAMGAGVLMP
    NCTC8325        NGVMIPLTAYLMDRIKTRPLYLAAMGTFLLGSIVAALAPNFGVLMLARVIQAMGAGVLMP
    Newman          NGVMIPLTAYLMDRIKTRPLYLAAMGTFLLGSIVAALAPNFGVLMLARVIQAMGAGVLMP
    USA300_FPR3757  NGVMIPLTAYLMDRIKTRPLYLAAMGTFLLGSIVAALAPNFGVLMLARVIQAMGAGVLMP
                    ************************************************************

    COL             LMQFTLFTLFSKEHRGFAMGLAGLVIQFAPAIGPTVTGLIIDQASWRVPFIIIVGIAILA
    N315            LMQFTLFTLFSKEHRGFAMGLAGLVIQFAPAIGPTVTGLIIDQASWRVPFIIIVGIALVA
    NCTC8325        LMQFTLFTLFSKEHRGFAMGLAGLVIQFAPAIGPTVTGLIIDQASWRVPFIIIVGIAILA
    Newman          LMQFTLFTLFSKEHRGFAMGLAGLVIQFAPAIGPTVTGLIIDQASWRVPFIIIVGIAILA
    USA300_FPR3757  LMQFTLFTLFSKEHRGFAMGLAGLVIQFAPAIGPTATGLIIDQASWRVPFIIILGIAILA
                    ***********************************.*****************:***::*

    COL             FVFGLVSISSYNEVKYTKLDKRSVMYSTIGFGLMLYAFSSAGDLGFTSPIVIGALILSMV
    N315            FVFGLVSISSYNEVKYTKLDKRSVMYSTIGFGLMLYAFSSAGDLGFTSPIVIGALIISMV
    NCTC8325        FVFGLVSISSYNEVKYTKLDKRSVMYSTIGFGLMLYAFSSAGDLGFTSPIVIGALILSMV
    Newman          FVFGLVSISSYNEVKYTKLDKRSVMYSTIGFGLMLYAFSSAGDLGFTSPIVIGALILSMV
    USA300_FPR3757  FVFGLVSISSYNEVKYTKLDKRSVMYSTIGFGLMLYAFSSAGDLGFTSPIVIGALILSMV
                    ********************************************************:***

    COL             IIYLFIRRQFNITNALLNLRVFKNRTFALCTISSMIIMMSMVGPALLIPLYVQNSLSLSA
    N315            IIYLFIRRQFNITNVLLNLRVFKNRTFALCTISSMIIMMSMVGPALLIPLYVQNSLSLSA
    NCTC8325        IIYLFIRRQFNITNALLNLRVFKNRTFALCTISSMIIMMSMVGPALLIPLYVQNSLSLSA
    Newman          IIYLFIRRQFNITNALLNLRVFKNRTFALCTISSMIIMMSMVGPALLIPLYVQNSLSLSA
    USA300_FPR3757  IIYLFIRRQFNITNALLNLRVFKNRTFALCTISSMIIMMSMVGPALLIPLYVQNSLSLSA
                    **************.*********************************************

    COL             LLSGLVIMPGAIINGIMSVFTGKFYDKYGPRPLIYTGFTILTITTIMLCFLHTDTSYTYL
    N315            LLSGLVIMPGAIINGIMSVFTGKFYDKYGPRPLIYTGFTILTITTIMLCFLHTDTSYTYL
    NCTC8325        LLSGLVIMPGAIINGIMSVFTGKFYDKYGPRPLIYTGFTILTITTIMLCFLHTDTSYTYL
    Newman          LLSGLVIMPGAIINGIMSVFTGKFYDKYGPRPLIYTGFTILTITTIMLCFLHTDTSYTYL
    USA300_FPR3757  LLSGLVIMPGAIINGIMSVFTGKFYDKYGPRPLIYTGFTILTITTIMLCFLHTDTSYTYL
                    ************************************************************

    COL             IVVYAIRMFSVSLLMMPINTTGINSLRNEEISHGTAIMNFGRVMAGSLGTALMVTLMSFG
    N315            IVVYAIRMFSVSLLMMPINTTGINSLRNEEISHGTAIMNFGRVMAGSLGTALMVTLMSFG
    NCTC8325        IVVYAIRMFSVSLLMMPINTTGINSLRNEEISHGTAIMNFGRVMAGSLGTALMVTLMSFG
    Newman          IVVYAIRMFSVSLLMMPINTTGINSLRNEEISHGTAIMNFGRVMAGSLGTALMVTLMSFG
    USA300_FPR3757  IVVYAIRMFSVSLLMMPINTTGINSLRNEEISHGTAIMNFGRVMAGSLGTALMVTLMSFG
                    ************************************************************

    COL             AKIFLSTSPSHLTATEIKQQSIAIGVDISFAFVAVLVMAAYVIALFIREPKEIESNRRKF
    N315            AKIFLSTSPSHLTATEIKQQSIAIGVDISFAFVAVLVMAAYVIALFIREPKEIESNRRKF
    NCTC8325        AKIFLSTSPSHLTATEIKQQSIAIGVDISFAFVAVLVMAAYVIALFIREPKEIESNRRKF
    Newman          AKIFLSTSPSHLTATEIKQQSIAIGVDISFAFVAVLVMAAYVIALFIREPKEIESNRRKF
    USA300_FPR3757  AKIFLSTSPSHLTATEIKQQSIAIGVDISFAFVAVLVMAAYVIALFIREPKEIESNRRKF
                    ************************************************************