From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005561000
  • symbol?:
  • description?: metal-dependent hydrolase

      descriptions from strain specific annotations:

    • metal-dependent hydrolase
    • Inner membrane protein YdjM
    • membrane-bound metal-dependent hydrolase
  • strand?: -
  • coordinates?: 5703530..5704045
  • synteny block?: BlockID0043210
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2110
    08BA02176:
    C248_2208
    11819-97:
    MS7_2195
    71193:
    ST398NM01_2232
    ECT-R 2:
    ECTR2_2033
    ED133:
    SAOV_2219c
    ED98:
    SAAV_2233
    HO 5096 0412:
    SAEMRSA15_20770
    JH1:
    SaurJH1_2241
    JH9:
    SaurJH9_2203
    JKD6008:
    SAA6008_02210
    JKD6159:
    SAA6159_02083
    LGA251:
    SARLGA251_19670
    M013:
    M013TW_2138
    MRSA252:
    SAR2263
    MSHR1132:
    SAMSHR1132_20040
    MSSA476:
    SAS2073
    Mu3:
    SAHV_2156
    Mu50:
    SAV2172
    MW2:
    MW2098
    RF122:
    SAB2053c
    ST398:
    SAPIG2232
    T0131:
    SAT0131_02341
    TCH60:
    HMPREF0772_11020
    TW20:
    SATW20_23070
    USA300_TCH1516:
    USA300HOU_2163
    VC40:
    SAVC_09730

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTGKTHALCGMLVGALTTQYFQTDIFSSVTVIILATLASLLPDICHTQSKIGRRFKVISF
    N315            MTGKTHASCGMLVGALTTQYFQTDIFSSVTVIILATLASLLPDICHTQSKIGRRFKVISF
    NCTC8325        MTGKTHASCGMLVGALTTQYFQTDIFSSVTVIILATLASLLPDICHTQSKIGRRFKVISF
    Newman          MTGKTHASCGMLVGALTTQYFQTDIFSSVTVIILATLASLLPDICHTQSKIGRRFKVISF
    USA300_FPR3757  MTGKTHASCGMLVGALTTQYFQTDIFSSVTVIILATLASLLPDICHTQSKIGRRFKVISF
                    ******* ****************************************************

    COL             FVRLIFGHRTFTHSILFIAIIAFLLQIIQTPNYYMAAIIIGLVSHVILDMITPKGVKLFY
    N315            FVRLIFGHRTFTHSILFIAIIAFLLQIIQTPNYYMAAIIIGLVSHVILDMITPRGVKLFY
    NCTC8325        FVRLIFGHRTFTHSILFIAIIAFLLQIIQTPNYYMAAIIIGLVSHVILDMITPKGVKLFY
    Newman          FVRLIFGHRTFTHSILFIAIIAFLLQIIQTPNYYMAAIIIGLVSHVILDMITPKGVKLFY
    USA300_FPR3757  FVRLIFGHRTFTHSILFIAIIAFLLQIIQTPNYYMAAIIIGLVSHVILDMITPKGVKLFY
                    *****************************************************:******

    COL             PLPFNVKTPIQFKTGGLVDLSLATALMVGTVYVLFQPFINDIISNWNTKFL
    N315            PLPFNVKTPIQFKTGGLVDLSLATALMVGTVYVLFQPFINDIISNWNTKFL
    NCTC8325        PLPFNVKTPIQFKTGGLVDLSLATALMVGTVYVLFQPFINDIISNWNTKFL
    Newman          PLPFNVKTPIQFKTGGLVDLSLATALMVGTVYVLFQPFINDIISNWNTKFL
    USA300_FPR3757  PLPFNVKTPIQFKTGGLVDLSLATALMVGTVYVLFQPFINDIISNWNTKFL
                    ***************************************************