From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005562000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 5704224..5704484
  • synteny block?: BlockID0043220
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2111
    08BA02176:
    C248_2209
    11819-97:
    MS7_2196
    71193:
    ST398NM01_2233
    ECT-R 2:
    ECTR2_2034
    ED133:
    SAOV_2220
    ED98:
    SAAV_2234
    HO 5096 0412:
    SAEMRSA15_20780
    JH1:
    SaurJH1_2242
    JH9:
    SaurJH9_2204
    JKD6008:
    SAA6008_02211
    JKD6159:
    SAA6159_02084
    LGA251:
    SARLGA251_19680
    M013:
    M013TW_2139
    MRSA252:
    SAR2264
    MSHR1132:
    SAMSHR1132_20050
    MSSA476:
    SAS2074
    Mu3:
    SAHV_2157
    Mu50:
    SAV2173
    MW2:
    MW2099
    RF122:
    SAB2054
    ST398:
    SAPIG2233
    T0131:
    SAT0131_02342
    TCH60:
    HMPREF0772_11019
    TW20:
    SATW20_23080
    USA300_TCH1516:
    USA300HOU_2164
    VC40:
    SAVC_09735

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAMTVKKDNNEVRIQWRVADIKIPTSEIKNITQDQDIHAVPKLDSKDVSRIGSTFGKTNR
    N315            MAMTVKKDNNEVRIQWRVADIKIPTSEIKNITQDQDIHAVPKLDSKDVSRIGSTFGKTNR
    NCTC8325        MAMTVKKDNNEVRIQWRVADIKIPTSEIKNITQDQDIHAVPKLDSKDVSRIGSTFGKTNR
    Newman          MAMTVKKDNNEVRIQWRVADIKIPTSEIKNITQDQDIHAVPKLDSKDVSRIGSTFGKTNR
    USA300_FPR3757  MAMTVKKDNNEVRIQWRVADIKIPTSEIKNITQDQDIHAVPKLDSKDVSRIGSTFGKTNR
                    ************************************************************

    COL             VIIDTEDHEYIIYTQNDQKVYNELTK
    N315            VIIDTEDHEYIIYTQNDQKVYNELTK
    NCTC8325        VIIDTEDHEYIIYTQNDQKVYNELTK
    Newman          VIIDTEDHEYIIYTQNDQKVYNELTK
    USA300_FPR3757  VIIDTEDHEYIIYTQNDQKVYNELTK
                    **************************