From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005564000
  • symbol?:
  • description?: membrane protein

      descriptions from strain specific annotations:

    • membrane protein
    • transporter gate domain-containing protein
    • membrane spanning protein
    • nucleoside recognition domain-containing protein
    • Nucleoside recognition domain protein
    • nucleoside recognition family protein
    • transporter gate domain protein
  • strand?: -
  • coordinates?: 5704637..5705830
  • synteny block?: BlockID0043240
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2112
    08BA02176:
    C248_2211
    11819-97:
    MS7_2197
    71193:
    ST398NM01_2234
    ECT-R 2:
    ECTR2_2035
    ED133:
    SAOV_2221c
    ED98:
    SAAV_2235
    HO 5096 0412:
    SAEMRSA15_20790
    JH1:
    SaurJH1_2243
    JH9:
    SaurJH9_2205
    JKD6008:
    SAA6008_02212
    JKD6159:
    SAA6159_02085
    LGA251:
    SARLGA251_19690
    M013:
    M013TW_2140
    MRSA252:
    SAR2265
    MSHR1132:
    SAMSHR1132_20060
    MSSA476:
    SAS2075
    Mu3:
    SAHV_2158
    Mu50:
    SAV2174
    MW2:
    MW2100
    RF122:
    SAB2055c
    ST398:
    SAPIG2234
    T0131:
    SAT0131_02343
    TCH60:
    HMPREF0772_11018
    TW20:
    SATW20_23090
    USA300_TCH1516:
    USA300HOU_2166
    VC40:
    SAVC_09740

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDSFSRKEIVIGRLKFITMSLIGILLFLVPIPVEQDGQKQTTLPVAFLAGVLKDVLGGVM
    N315            MDSFSRKEIVIGRLKFITMSLIGILLFLVPIPVEQDGQKQTTLPVAFLAGVLKDVLGGVM
    NCTC8325        -----------------------------------------------------------M
    Newman          MDSFSRKEIVIGRLKFITMSLIGILLFLVPIPVEQDGQKQTTLPVAFLAGVLKDVLGGVM
    USA300_FPR3757  ------------------MSLIGILLFLVPIPVEQDGQKQTTLPVAFLAGVLKDVLGGVM
                                                                               *

    COL             PFLIVTIITLSGIITLICSTILKDKLKPDGLMNNAFNVRIGWLILRILAVVFAWMTFLRI
    N315            PFLIVTIITLSGIITLICSTILKDKLKPDGLMNNAFNVRIGWLILRILAVVFAWMTFLRI
    NCTC8325        PFLIVTIITLSGIITLICSTILKDKLKPDGLMNNAFNVRIGWLILRILAVVFAWMTFLRI
    Newman          PFLIVTIITLSGIITLICSTILKDKLKPDGLMNNAFNVRIGWLILRILAVVFAWMTFLRI
    USA300_FPR3757  PFLIVTIITLSGIITLICSTILKDKLKPDGLMNNAFNVRIGWLILRILAVVFAWMTFLRI
                    ************************************************************

    COL             GSKVIYSDETGGLLFSSLLPTLVAVFLFAALFLPLLMEYGLLEMLGPIFRPVMRPLFTLP
    N315            GSKVIYSDETGGLLFSSLLPTLVAVFLFAALFLPLLMEYGLLEMLGPIFRPVMRPLFTLP
    NCTC8325        GSKVIYSDETGGLLFSSLLPTLVAVFLFAALFLPLLMEYGLLEMLGPIFRPVMRPLFTLP
    Newman          GSKVIYSDETGGLLFSSLLPTLVAVFLFAALFLPLLMEYGLLEMLGPIFRPVMRPLFTLP
    USA300_FPR3757  GSKVIYSDETGGLLFSSLLPTLVAVFLFAALFLPLLMEYGLLEMLGPIFRPVMRPLFTLP
                    ************************************************************

    COL             GRSTVDNLASFIGDGTVGVLITSRQYGEGYYSRREATVISTTFSVVSITFAIVVAETVHM
    N315            GRSTVDNLASFIGDGTVGVLITSRQYGEGYYSRREATVISTTFSVVSITFAIVVAETVHM
    NCTC8325        GRSTVDNLASFIGDGTVGVLITSRQYGEGYYSRREATVISTTFSVVSITFAIVVAETVHM
    Newman          GRSTVDNLASFIGDGTVGVLITSRQYGEGYYSRREATVISTTFSVVSITFAIVVAETVHM
    USA300_FPR3757  GRSTVDNLASFIGDGTVGVLITSRQYGEGYYSRREATVISTTFSVVSITFAIVVAETVHM
                    ************************************************************

    COL             QNQFFAFYLSVIVSCLVAAVIMPRIWPLNKIPDEYAKEVPESARTEALPEGKTALRHGFD
    N315            QNQFFAFYLSVIVSCLVAAVIMPRIWPLNKIPDEYAKEVPESARTEALPEGKTALRHGFD
    NCTC8325        QNQFFAFYLSVIVSCLVAAVIMPRIWPLNKIPDEYAKEVPESARTEALPEGKTALRHGFD
    Newman          QNQFFAFYLSVIVSCLVAAVIMPRIWPLNKIPDEYAKEVPESARTEALPEGKMALRHGFD
    USA300_FPR3757  QNQFFAFYLSVIVSCLVAAVIMPRIWPLNKIPDEYAKEVPESARTEALPEGKTALRHGFD
                    **************************************************** *******

    COL             TATEVGIKAPGVIDFFKSGLKTVIDMWFVILPVVMSIGTIATIIANYTPFFVILGKPFVP
    N315            TATEVGIKAPGVIDFFKSGLKTVIDMWFVILPVVMSIGTIATIIANYTPFFVILGKPFVP
    NCTC8325        TATEVGIKAPGVIDFFKSGLKTVIDMWFVILPVVMSIGTIATIIANYTPFFVILGKPFVP
    Newman          TATEVGIKAPGVIDFFKSGLKTVIDMWFVILPVVMSIGTIATIIANYTPFFVILGKPFVP
    USA300_FPR3757  TATEVGIKAPGVIDFFKSGLKTVIDMWFVILPVVMSIGTIATIIANYTPFFVILGKPFVP
                    ************************************************************

    COL             FLELMQIPEAAQASQTIIIGFADMFLPSILIEGVQNDITRFVIGALSISQLIYLSEVGGV
    N315            FLELMQIPEAAQASQTIIIGFADMFLPSILIEGVQNDITRFVIGALSISQLIYLSEVGGV
    NCTC8325        FLELMQIPEAAQASQTIIIGFADMFLPSILIEGVQNDITRFVIGALSISQLIYLSEVGGV
    Newman          FLELMQIPEAAQASQTIIIGFADMFLPSILIEGVQNDITRFVIGALSISQLIYLSEVGGV
    USA300_FPR3757  FLELMQIPEAAQASQTIIIGFADMFLPSILIEGVQNDITRFVIGALSISQLIYLSEVGGV
                    ************************************************************

    COL             ILGSKIPVSIGKLFMIFLIRTIITLPIISLMAHLLL
    N315            ILGSKIPVSIGKLFMIFLIRTIITLPIISLMAHLLL
    NCTC8325        ILGSKIPVSIGKLFMIFLIRTIITLPIISLMAHLLL
    Newman          ILGSKIPVSIGKLFMIFLIRTIITLPIISLMAHLLL
    USA300_FPR3757  ILGSKIPVSIGKLFMIFLIRTIITLPIISLMAHLLL
                    ************************************