From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005565000
  • symbol?: htsC
  • description?: ferrichrome ABC transporter permease

      descriptions from strain specific annotations:

    • ferrichrome ABC transporter permease
    • heme transport system permease
    • transport system permease protein
    • iron compound ABC transporter, permease protein
    • Heme ABC type transporter HtsABC, permease protein HtsC
    • iron(III) dicitrate transport system permease protein fecD
    • FecCD transport family protein
    • iron compound ABC transporter permease
    • FecCD iron compound ABC transporter permease family protein
    • iron (Fe3+) ABC transporter membrane protein
    • iron (Fe3+) ABC superfamily ATP binding cassette transporter, membrane protein
    • FecCD iron compound ABC transporter, permease family protein
    • fe(3+) dicitrate transport system permease protein fecD
  • strand?: -
  • coordinates?: 5706245..5707123
  • synteny block?: BlockID0043250
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2113 (htsC)
    08BA02176:
    C248_2212
    11819-97:
    MS7_2198 (fecD)
    71193:
    ST398NM01_2235
    ECT-R 2:
    ECTR2_2036
    ED133:
    SAOV_2222c
    ED98:
    SAAV_2236
    HO 5096 0412:
    SAEMRSA15_20800
    JH1:
    SaurJH1_2244
    JH9:
    SaurJH9_2206
    JKD6008:
    SAA6008_02213 (htsC)
    JKD6159:
    SAA6159_02086 (htsC)
    LGA251:
    SARLGA251_19700
    M013:
    M013TW_2141
    MRSA252:
    SAR2266
    MSHR1132:
    SAMSHR1132_20070
    MSSA476:
    SAS2076
    Mu3:
    SAHV_2159
    Mu50:
    SAV2175 (htsC)
    MW2:
    MW2101
    RF122:
    SAB2056c
    ST398:
    SAPIG2235
    T0131:
    SAT0131_02344
    TCH60:
    HMPREF0772_11017 (htsC)
    TW20:
    SATW20_23100
    USA300_TCH1516:
    USA300HOU_2167
    VC40:
    SAVC_09745

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MMTTKIIRRYSLITILLIVSIFISLCVGSVMIHPIDAIKGIFTQDDFILNEYRIPRTLLG
    N315            MMTTKIIRRYSLITILLIVSIFISLCVGSVMIHPIDAIKGIFTQDDFILNEYRIPRTLLG
    NCTC8325        MMTTKIIRRYSLITILLIVSIFISLCVGSVMIHPIDAIKGIFTQDDFILNEYRIPRTLLG
    Newman          MMTTKIIRRYSLITILLIVSIFISLCVGSVMIHPIDAIKGIFTQDDFILNEYRIPRTLLG
    USA300_FPR3757  MMTTKIIRRYSLITILLIVSIFISLCVGSVMIHPIDAIKGIFTQDDFILNEYRIPRTLLG
                    ************************************************************

    COL             IIIGSSLAISGAIIQAVIRNPLASPDVIGISKGASLAAVIIIMTFPTAPLFVLPIGSFLG
    N315            IIIGSSLAISGAIIQAVIRNPLASPDVIGISKGASLAAVIIIMIFPTAPLFVLPIGSFLG
    NCTC8325        IIIGSSLAISGAIIQAVIRNPLASPDVIGISKGASLAAVIIIMTFPTAPLFVLPIGSFLG
    Newman          IIIGSSLAISGAIIQAVIRNPLASPDVIGISKGASLAAVIIIMTFPTAPLFVLPIGSFLG
    USA300_FPR3757  IIIGSSLAISGAIIQAVIRNPLASPDVIGISKGASLAAVIIIMTFPTAPLFVLPIGSFLG
                    ******************************************* ****************

    COL             AFAVSLFLSFLISKYDVKGSKLALIGLAIGAICTAIVQFLLIRNPLEANKALVWLTGSLY
    N315            AFAVSLFLSFLISKYDVKGSKLALIGLAIGAICTAIVQFLLIRNPLEANKALVWLTGSLY
    NCTC8325        AFAVSLFLSFLISKYDVKGSKLALIGLAIGAICTAIVQFLLIRNPLEANKALVWLTGSLY
    Newman          AFAVSLFLSFLISKYDVKGSKLALIGLAIGAICTAIVQFLLIRNPLEANKALVWLTGSLY
    USA300_FPR3757  AFAVSLFLSFLISKYDVKGSKLALIGLAIGAICTAIVQFLLIRNPLEANKALVWLTGSLY
                    ************************************************************

    COL             GHDMSNIYTILPWFLITIPIIILLSYQLDVLNLGDAVATALGLKVKTIKMLLLILAVILA
    N315            GHDMSNIYTILPWFLITIPIIILLSYQLDVLNLGDAVATALGLKVKTIKMLLLILAVILA
    NCTC8325        GHDMSNIYTILPWFLITIPIIILLSYQLDVLNLGDAVATALGLKVKTIKMLLLILAVILA
    Newman          GHDMSNIYTILPWFLITIPIIILLSYQLDVLNLGDAVATALGLKVKTIKMLLLILAVILA
    USA300_FPR3757  GHDMSNIYTILPWFLITIPIIILLSYQLDVLNLGDAVATALGLKVKTIKMLLLILAVILA
                    ************************************************************

    COL             GSAISVVGGISFLGLIAPHIARQLIGNKTLHVIIMSGLIGAILLTFGDGLARGIHPPLDI
    N315            GSAISVVGGISFLGLIAPHIARQLIGNKTLHVIIMSGLIGAILLTFGDGLARGIHPPLDI
    NCTC8325        GSAISVVGGISFLGLIAPHIARQLIGNKTLHVIIMSGLIGAILLTFGDGLARGIHPPLDI
    Newman          GSAISVVGGISFLGLIAPHIARQLIGNKTLHVIIMSGLIGAILLTFGDGLARGIHPPLDI
    USA300_FPR3757  GSAISVVGGISFLGLIAPHIARQLIGNKTLHVIIMSGLIGAILLTFGDGLARGIHPPLDI
                    ************************************************************

    COL             PVGVIIAIIGAPYFLILLRRMK
    N315            PVGVIIAIIGAPYFLILLRRMK
    NCTC8325        PVGVIIAIIGAPYFLILLRRMK
    Newman          PVGVIIAIIGAPYFLILLRRMK
    USA300_FPR3757  PVGVIIAIIGAPYFLILLRRMK
                    **********************