From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005567000
  • symbol?: htsA
  • description?: ABC transporter substrate-binding protein

      descriptions from strain specific annotations:

    • ABC transporter substrate-binding protein
    • iron compound ABC transporter iron compound-binding protein
    • ferrichrome ABC transporter lipoprotein
    • periplasmic binding protein
    • ABC transporter periplasmic binding protein
    • ferrichrome-binding protein
    • Heme ABC type transporter HtsABC, heme-binding protein
    • heme transport system lipoprotein
    • iron (Fe3+) ABC superfamily ATP binding cassette transporter, binding protein
    • iron (Fe3+) ABC transporter binding protein
    • iron(III) dicitrate-binding protein
    • iron compound ABC transporter, iron compound-binding protein
    • iron-dicitrate transporter substrate-binding subunit, FecB
    • putative transport system binding lipoprotein
  • strand?: -
  • coordinates?: 5708253..5709236
  • synteny block?: BlockID0043270
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2115 (htsA)
    08BA02176:
    C248_2214
    11819-97:
    MS7_2200
    71193:
    ST398NM01_2237
    ECT-R 2:
    ECTR2_2038
    ED133:
    SAOV_2224c
    ED98:
    SAAV_2238
    HO 5096 0412:
    SAEMRSA15_20820
    JH1:
    SaurJH1_2246
    JH9:
    SaurJH9_2208
    JKD6008:
    SAA6008_02215 (fecB)
    JKD6159:
    SAA6159_02088 (fecB)
    LGA251:
    SARLGA251_19720
    M013:
    M013TW_2143
    MRSA252:
    SAR2268
    MSHR1132:
    SAMSHR1132_20090
    MSSA476:
    SAS2078
    Mu3:
    SAHV_2161
    Mu50:
    SAV2177 (htsA)
    MW2:
    MW2103
    RF122:
    SAB2058c
    ST398:
    SAPIG2237
    T0131:
    SAT0131_02346
    TCH60:
    HMPREF0772_11015
    TW20:
    SATW20_23120
    USA300_TCH1516:
    USA300HOU_2169
    VC40:
    SAVC_09755

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRGLKTFSILGLIVALLLVAACGNTDNSSKKESSTKDTISVKDENGTVKVPKDAKRIVVL
    N315            MRGLKTFSILGLIVALLLVAACGNTDNSSKKESSTKDTISVKDENGTVKVPKDAKRIVVL
    NCTC8325        MRGLKTFSILGLIVALLLVAACGNTDNSSKKESSTKDTISVKDENGTVKVPKDAKRIVVL
    Newman          MRGLKTFSILGLIVALLLVAACGNTDNSSKKESSTKDTISVKDENGTVKVPKDAKRIVVL
    USA300_FPR3757  MRGLKTFSILGLIVALLLVAACGNTDNSSKKESSTKDTISVKDENGTVKVPKDAKRIVVL
                    ************************************************************

    COL             EYSFADALAALDVKPVGIADDGKKKRIIKPVREKIGDYTSVGTRKQPNLEEISKLKPDLI
    N315            EYSFADALAALDVKPVGIADDGKKKRIIKPVREKIGDYTSVGTRKQPNLEEISKLKPDLI
    NCTC8325        EYSFADALAALDVKPVGIADDGKKKRIIKPVREKIGDYTSVGTRKQPNLEEISKLKPDLI
    Newman          EYSFADALAALDVKPVGIADDGKKKRIIKPVREKIGDYTSVGTRKQPNLEEISKLKPDLI
    USA300_FPR3757  EYSFADALAALDVKPVGIADDGKKKRIIKPVREKIGDYTSVGTRKQPNLEEISKLKPDLI
                    ************************************************************

    COL             IADSSRHKGINKELNKIAPTLSLKSFDGDYKQNINSFKTIAKALNKEKEGEKRLAEHDKL
    N315            IADSSRHKGINKELNKIAPTLSLKSFDGDYKQNINSFKTIAKALNKEKEGEKRLAEHDKL
    NCTC8325        IADSSRHKGINKELNKIAPTLSLKSFDGDYKQNINSFKTIAKALNKEKEGEKRLAEHDKL
    Newman          IADSSRHKGINKELNKIAPTLSLKSFDGDYKQNINSFKTIAKALNKEKEGEKRLAEHDKL
    USA300_FPR3757  IADSSRHKGINKELNKIAPTLSLKSFDGDYKQNINSFKTIAKALNKEKEGEKRLAEHDKL
                    ************************************************************

    COL             INKYKDEIKFDRNQKVLPAVVAKAGLLAHPNYSYVGQFLNELGFKNALSDDVTKGLSKYL
    N315            INKYKDEIKFDRNQKVLPAVVAKAGLLAHPNYSYVGQFLNELGFKNALSDDVTKGLSKYL
    NCTC8325        INKYKDEIKFDRNQKVLPAVVAKAGLLAHPNYSYVGQFLNELGFKNALSDDVTKGLSKYL
    Newman          INKYKDEIKFDRNQKVLPAVVAKAGLLAHPNYSYVGQFLNELGFKNALSDDVTKGLSKYL
    USA300_FPR3757  INKYKDEIKFDRNQKVLPAVVAKAGLLAHPNYSYVGQFLNELGFKNALSDDVTKGLSKYL
                    ************************************************************

    COL             KGPYLQLDTEHLADLNPERMIIMTDHAKKDSAEFKKLQEDATWKKLNAVKNNRVDIVDRD
    N315            KGPYLQLDTEHLADLNPERMIIMTDHAKKDSAEFKKLQEDATWKKLNAVKNNRVDIVDRD
    NCTC8325        KGPYLQLDTEHLADLNPERMIIMTDHAKKDSAEFKKLQEDATWKKLNAVKNNRVDIVDRD
    Newman          KGPYLQLDTEHLADLNPERMIIMTDHAKKDSAEFKKLQEDATWKKLNAVKNNRVDIVDRD
    USA300_FPR3757  KGPYLQLDTEHLADLNPERMIIMTDHAKKDSAEFKKLQEDATWKKLNAVKNNRVDIVDRD
                    ************************************************************

    COL             VWARSRGLISSEEMAKELVELSKKEQK
    N315            VWARSRGLISSEEMAKELVELSKKEQK
    NCTC8325        VWARSRGLISSEEMAKELVELSKKEQK
    Newman          VWARSRGLISSEEMAKELVELSKKEQK
    USA300_FPR3757  VWARSRGLISSEEMAKELVELSKKEQK
                    ***************************