From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005569000
  • symbol?:
  • description?: alanine racemase domain-containing protein

      descriptions from strain specific annotations:

    • alanine racemase domain-containing protein
    • alanine racemase, N-domain family
  • strand?: -
  • coordinates?: 5709951..5711021
  • synteny block?: BlockID0043290
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2116
    08BA02176:
    C248_2216
    11819-97:
    MS7_2201
    71193:
    ST398NM01_2238
    ECT-R 2:
    ECTR2_2039
    ED133:
    SAOV_2225c
    ED98:
    SAAV_2239
    HO 5096 0412:
    SAEMRSA15_20830
    JH1:
    SaurJH1_2248
    JH9:
    SaurJH9_2209
    JKD6008:
    SAA6008_02216
    JKD6159:
    SAA6159_02089
    LGA251:
    SARLGA251_19730
    M013:
    M013TW_2144
    MRSA252:
    SAR2269
    MSHR1132:
    SAMSHR1132_20100
    MSSA476:
    SAS2079
    Mu3:
    SAHV_2162
    Mu50:
    SAV2178
    MW2:
    MW2104
    RF122:
    SAB2059c
    ST398:
    SAPIG2238
    T0131:
    SAT0131_02347
    TCH60:
    HMPREF0772_11013
    TW20:
    SATW20_23130
    USA300_TCH1516:
    USA300HOU_2170
    VC40:
    SAVC_09760

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAHVNINISKIKYNAKVLQTVFQSKNMQFTPVIKCIAGDRTIVESLKALGINHVAESRLD
    N315            MAHVNINISKIKYNAKVLQTVFQSKNIQFTPVIKCIAGDRTIVESLKALGINHVAESRLD
    NCTC8325        MAHVNINISKIKYNAKVLQTVFQSKNMQFTPVIKCIAGDRTIVESLKALGINHVAESRLD
    Newman          MAHVNINISKIKYNAKVLQTVFQSKNMQFTPVIKCIAGDRTIVESLKALGINHVAESRLD
    USA300_FPR3757  MAHVNINISKIKYNAKVLQTVFQSKNMQFTPVIKCIAGDRTIVESLKALGINHVAESRLD
                    **************************:*********************************

    COL             NIISIADQDLTYTLLRTPAKKEISDMIEKVDMSIQTELSTIHQINEVAEVLGKKHKILLM
    N315            NIISIADQDLTYTLLRTPAKKEISDMIEKVDMSIQTELSTIHQINEVAEVLGKKHKILLM
    NCTC8325        NIISIADQDLTYTLLRTPAKKEISDMIEKVDMSIQTELSTIHQINEVAEVLGKKHKILLM
    Newman          NIISIADQDLTYTLLRTPAKKEISDMIEKVDMSIQTELSTIHQINEVAEVLGKKHKILLM
    USA300_FPR3757  NIISIADQDLTYTLLRTPAKKEISDMIEKVDMSIQTELSTIHQINEVAEVLGKKHKILLM
                    ************************************************************

    COL             VDWKDGREGVLTYDVLDYIKEIIHLKNIHFVGLAFNFMCFKSDAPSDDDIFMINRFVSAV
    N315            VDWKDGREGVLTYDVLDYIKEIIHLKNIHFVGLAFNFMCFKSDAPSDDDIFMINRFVSAV
    NCTC8325        VDWKDGREGVLTYDVLDYIKEIIHLKNIHFVGLAFNFMCFKSDAPSDDDIFMINRFVSAV
    Newman          VDWKDGREGVLTYDVLDYIKEIIHLKNIHFVGLAFNFMCFKSDAPSDDDIFMINRFVSAV
    USA300_FPR3757  VDWKDGREGVLTYDVLDYIKEIIHLKNIHFVGLAFNFMCFKSDAPSDDDIFMINRFVSAV
                    ************************************************************

    COL             EREIGYRLKIISGGNSSMLPQLLYNDLGKINELRIGETLFRGVDTTTNQAIAMLYQDAIT
    N315            EREIGYRLKIISGGNSSMLPQLLYNDLGKINELRIGETLFRGVDTTTNQAIAMLYQDAIT
    NCTC8325        EREIGYRLKIISGGNSSMLPQLLYNDLGKINELRIGETLFRGVDTTTNQAIAMLYQDAIT
    Newman          EREIGYRLKIISGGNSSMLPQLLYNDLGKINELRIGETLFRGVDTTTNQAIAMLYQDAIT
    USA300_FPR3757  EREIGYRLKIISGGNSSMLPQLLYNDLGKINELRIGETLFRGVDTTTNQAIAMLYQDAIT
                    ************************************************************

    COL             LEAEILEIKPRVNTQTHESFLQAIVDIGYLDTKVDNISPMDQHINILGASSDHLMLDLNG
    N315            LEAEILEIKPRVNTQTHESFLQAIVDIGYLDTKVDNISPMDQHINILGASSDHLMLDLNG
    NCTC8325        LEAEILEIKPRVNTQTHESFLQAIVDIGYLDTKVDNISPMDQHINILGASSDHLMLDLNG
    Newman          LEAEILEIKPRVNTQTHESFLQAIVDIGYLDTKVDNISPMDQHINILGASSDHLMLDLNG
    USA300_FPR3757  LEAEILEIKPRVNTQTHESFLQAIVDIGYLDTKVDNISPMDQHINILGASSDHLMLDLNG
                    ************************************************************

    COL             QGHYQVGDHISFSLNYEALSHSMYMKNLHKVYIDDSKIDTLLQNFDVKSPAMVNHY
    N315            QGHYQVGDHISFSLNYEALSHSMYMKNLHKVYIDDSKIDTLLQNFDVKSPAMVNQY
    NCTC8325        QGHYQVGDHISFSLNYEALSHSMYMKNLHKVYIDDSKIDTLLQNFDVKSPAMVNHY
    Newman          QGHYQVGDHISFSLNYEALSHSMYMKNLHKVYIDDSKIDTLLQNFDVKSPAMVNHY
    USA300_FPR3757  QGHYQVGDHISFSLNYEALSHSMYMKNLHKVYIDDSKIDTLLQNFDVKSPAMVNHY
                    ******************************************************:*