From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005571000
  • symbol?:
  • description?: MFS transporter

      descriptions from strain specific annotations:

    • MFS transporter
    • transporter
    • putative transporter
    • Macrolide-efflux protein
    • major facilitator superfamily protein
    • major facilitator superfamily protein (MFS)
    • major facilitator superfamily transporter
    • major facilitator transporter
    • membrane transporter
    • membrane transport protein
    • MFS family major facilitator transporter
    • transporter, putative
  • strand?: -
  • coordinates?: 5712778..5713815
  • synteny block?: BlockID0043310
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2118
    08BA02176:
    C248_2218
    11819-97:
    MS7_2203
    71193:
    ST398NM01_2240
    ECT-R 2:
    ECTR2_2041
    ED133:
    SAOV_2227c
    ED98:
    SAAV_2241
    HO 5096 0412:
    SAEMRSA15_20850
    JH1:
    SaurJH1_2250
    JH9:
    SaurJH9_2211
    JKD6008:
    SAA6008_02218
    JKD6159:
    SAA6159_02091
    LGA251:
    SARLGA251_19750
    M013:
    M013TW_2146
    MRSA252:
    SAR2271
    MSHR1132:
    SAMSHR1132_20120
    MSSA476:
    SAS2081
    Mu3:
    SAHV_2164
    Mu50:
    SAV2180
    MW2:
    MW2106
    RF122:
    SAB2061c
    ST398:
    SAPIG2240
    T0131:
    SAT0131_02349
    TCH60:
    HMPREF0772_11011
    TW20:
    SATW20_23150
    USA300_TCH1516:
    USA300HOU_2172
    VC40:
    SAVC_09770

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKYFFSSSFLLFLGNWIGQIGLNWFVLTTYHNAVYLGIVNFCRLVPILLLSVWAGAIAD
    N315            MTKYFFSSSFLLFLGNWIGQIGLNWFVLTTYHNAVYLGIVNFCRLVPILLLSVWAGAIAD
    NCTC8325        MTKYFFSSSFLLFLGNWIGQIGLNWFVLTTYHNAVYLGIVNFCRLVPILLLSVWAGAIAD
    Newman          MTKYFFSSSFLLFLGNWIGQIGLNWFVLTTYHNAVYLGIVNFCRLVPILLLSVWAGAIAD
    USA300_FPR3757  MTKYFFSSSFLLFLGNWIGQIGLNWFVLTTYHNAVYLGIVNFCRLVPILLLSVWAGAIAD
                    ************************************************************

    COL             KYDKGRLLRITISSSFLVTAILCVLTYSFTAIPISVIIIYATLRGILSAVETPLRQAILP
    N315            KYDKGRLLRITISSSFLVTAILCVLTYSFTAIPISVIIIYATLRGILSAVETPLRQAILP
    NCTC8325        KYDKGRLLRITISSSFLVTAILCVLTYSFTAIPISVIIIYATLRGILSAVETPLRQAILP
    Newman          KYDKGRLLRITISSSFLVTAILCVLTYSFTAIPISVIIIYATLRGILSAVETPLRQAILP
    USA300_FPR3757  KYDKGRLLRITISSSFLVTAILCVLTYSFTAIPISVIIIYATLRGILSAVETPLRQAILP
                    ************************************************************

    COL             DLSDKISTTQAVSFHSFIINICRSIGPAIAGVILAVYHAPTTFLAQAICYFIAVLLCLPL
    N315            DLSDKISTTQAVSFHSFIINICRSIGPAIAGVILAVYHAPTTFLAQAICYFIAALLCLPL
    NCTC8325        DLSDKISTTQAVSFHSFIINICRSIGPAIAGVILAVYHAPTTFLAQAICYFIAVLLCLPL
    Newman          DLSDKISTTQAVSFHSFIINICRSIGPAIAGVILAVYHAPTTFLAQAICYFIAVLLCLPL
    USA300_FPR3757  DLSDKISTTQAVSFHSFIINICRSIGPAIAGVILAVYHAPTTFLAQAICYFIAVLLCLPL
                    *****************************************************.******

    COL             HFKVTKIPEDASRYMPLKVIIDYFKLHMEGRQIFITSLLIMATGFSYTTLLPVLTNKVFP
    N315            HFKVTKIPEDATRYMPLKVIIDYFKLHMEGRQIFITSLLIMATGFSYTTLLPVLTNKVFP
    NCTC8325        HFKVTKIPEDASRYMPLKVIIDYFKLHMEGRQIFITSLLIMATGFSYTTLLPVLTNKVFP
    Newman          HFKVTKIPEDASRYMPLKVIIDYFKLHMEGRQIFITSLLIMATGFSYTTLLPVLTNKVFP
    USA300_FPR3757  HFKVTKIPEDASRYMPLKVIIDYFKLHMEGRQIFITSLLIMATGFSYTTLLPVLTNKVFP
                    ***********:************************************************

    COL             GKSEIFGIAMTMCAIGGIIATLVLPKVLKYIGMVNMYYLSSFLFGIALLGVVFHNIVIMF
    N315            GKSEIFGIAMTMCAIGGIIATLVLPKVLKYIGMVNMYYLSSLLFGIALLGVVFHNIVIMF
    NCTC8325        GKSEIFGIAMTMCAIGGIIATLVLPKVLKYIGMVNMYYLSSFLFGIALLGVVFHNIVIMF
    Newman          GKSEIFGIAMTMCAIGGIIATLVLPKVLKYIGMVNMYYLSSFLFGIALLGVVFHNIVIMF
    USA300_FPR3757  GKSEIFGIAMTMCAIGGIIATLVLPKVLKYIGMVNMYYLSSFLFGIALLGVVFHNIVIMF
                    *****************************************:******************

    COL             ICITLIGLFSQWARTTNRVYFQNNVKDYERGKVLSIIMMDRGMIPLGSLLMSICADVFGI
    N315            ICITLIGLFSQWARTTNRVYFQNNVKDYERGKVLSIIMMDRGMIPLGSLLMSICADVFGI
    NCTC8325        ICITLIGLFSQWARTTNRVYFQNNVKDYERGKVLSIIMMDRGMIPLGSLLMSICADVFGI
    Newman          ICITLIGLFSQWARTTNRVYFQNNVKDYERGKVLSIIMMDRGMIPLGSLLMSICADVFGI
    USA300_FPR3757  ICITLIGLFSQWARTTNRVYFQNNVKDYERGKVLSIIMMDRGMIPLGSLLMSICADVFGI
                    ************************************************************

    COL             VRTFSIMGISTICITMVFYFINRKLKLKLEESNHGIS
    N315            VRTFSIMGISTICITMVFYFINRKLKLKLEESNHGIS
    NCTC8325        VRTFSIMGISTICITMVFYFINRKLKLKLEESNHGIS
    Newman          VRTFSIMGISTICITMVFYFINRKLKLKLEESNHGIS
    USA300_FPR3757  VRTFSIMGISTICITMVFYFINRKLKLKLEESNHGIS
                    *************************************