From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005572000
  • symbol?:
  • description?: aerobactin biosynthesis protein

      descriptions from strain specific annotations:

    • aerobactin biosynthesis protein
    • Siderophore biosynthesis protein
    • iucA / IucC family protein
    • aerobactin biosynthesis protein, IucA/IucC family
    • Aerobactin biosynthesis IucA/IucC family protein
    • putative siderophore biosynthesis protein
    • IucA/IucC family aerobactin biosynthesis protein
    • Siderophore synthase
  • strand?: +
  • coordinates?: 5714073..5716046
  • synteny block?: BlockID0043320
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2119
    08BA02176:
    C248_2219
    11819-97:
    MS7_2204
    71193:
    ST398NM01_2241
    ECT-R 2:
    ECTR2_2042
    ED133:
    SAOV_2228
    ED98:
    SAAV_2242
    HO 5096 0412:
    SAEMRSA15_20860
    JH1:
    SaurJH1_2251
    JH9:
    SaurJH9_2212
    JKD6008:
    SAA6008_02219
    JKD6159:
    SAA6159_02092
    LGA251:
    SARLGA251_19760
    M013:
    M013TW_2147
    MRSA252:
    SAR2272
    MSHR1132:
    SAMSHR1132_20130
    MSSA476:
    SAS2082
    Mu3:
    SAHV_2165
    Mu50:
    SAV2181
    MW2:
    MW2107
    RF122:
    SAB2062
    ST398:
    SAPIG2241
    T0131:
    SAT0131_02350
    TCH60:
    HMPREF0772_11010
    TW20:
    SATW20_23160
    USA300_TCH1516:
    USA300HOU_2173
    VC40:
    SAVC_09775

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNLNLIFKEQTLKFNKEEQETYLFLQQHNSDWANIFKEMILQGRDKVTQRLVTSMHRENL
    N315            MNLNLIFKEQTLKFNKEEQETYLFLQQHNSDWANIFKEMILQGRDKVTQRLVTSMHRENL
    NCTC8325        MNLNLIFKEQTLKFNKEEQETYLFLQQHNSDWANIFKEMILQGRDKVTQRLVTSMHRENL
    Newman          MNLNLIFKEQTLKFNKEEQETYLFLQQHNSDWANIFKEMILQGRDKVTQRLVTSMHRENL
    USA300_FPR3757  MNLNLIFKEQTLKFNKEEQETYLFLQQHNSDWANIFKEMILQGRDKVTQRLVTSMHRENL
                    ************************************************************

    COL             VKARTQSKKILSRDLIMLDISTTHILEIQFPQAKQTLYAPITGEHAFDRIDVEGPFYIKD
    N315            VKARTQSKKILSRDLIMLDISTTHILEIQFPQAKQTLYAPITGEHAFDRIDVEGPFYIKD
    NCTC8325        VKARTQSKKILSRDLIMLDISTTHILEIQFPQAKQTLYAPITGEHAFDRIDVEGPFYIKD
    Newman          VKARTQSKKILSRDLIMLDISTTHILEIQFPQAKQTLYAPITGEHAFDRIDVEGPFYIKD
    USA300_FPR3757  VKARTQSKKILSRDLIMLDISTTHILEIQFPQAKQTLYAPITGEHAFDRIDVEGPFYIKD
                    ************************************************************

    COL             DITNTITRVHHPNEILECILIEAPDLKNAASDQFQQDLINSATNMTFAISYQALSMQHDS
    N315            DITNTITRVHHPNEILECILIEAPDLKNAASDQFQQDLINSATNMTFAISYQALSMQHDS
    NCTC8325        DITNTITRVHHPNEILECILIEAPDLKNAASDQFQQDLINSATNMTFAISYQALSMQHDS
    Newman          DITNTITRVHHPNEILECILIEAPDLKNAASDQFQQDLINSATNMTFAISYQALSMQHDS
    USA300_FPR3757  DITNTITRVHHPNEILECILIEAPDLKNAASDQFQQDLINSATNMTFAISYQALSMQHDS
                    ************************************************************

    COL             APLFNIIENSEDSYLRSEQAVIEGHPLHPGAKLRKGLNALQTFLYSSEFNQPIKLKIVLI
    N315            APLFNIIENSEDSYLRSEQAVIEGHPLHPGAKLRKGLNALQTFLYSSEFNQPIKLKIVLI
    NCTC8325        APLFNIIENSEDSYLRSEQAVIEGHPLHPGAKLRKGLNALQTFLYSSEFNQPIKLKIVLI
    Newman          APLFNIIENSEDSYLRSEQAVIEGHPLHPGAKLRKGLNALQTFLYSSEFNQPIKLKIVLI
    USA300_FPR3757  APLFNIIENSEDSYLRSEQAVIEGHPLHPGAKLRKGLNALQTFLYSSEFNQPIKLKIVLI
                    ************************************************************

    COL             HSKLSRTMSLSKDYDTTVHQLFPDLIKQLENEFTPKFNFNDYHIMIVHPWQLDDVLHSDY
    N315            HSKLSRTMSLSKDYDTTVHQLFPDLIKQLENEFTPNFNFNDYHIMIVHPWQLDDVLHSDY
    NCTC8325        HSKLSRTMSLSKDYDTTVHQLFPDLIKQLENEFTPKFNFNDYHIMIVHPWQLDDVLHSDY
    Newman          HSKLSRTMSLSKDYDTTVHQLFPDLIKQLENEFTPKFNFNDYHIMIVHPWQLDDVLHSDY
    USA300_FPR3757  HSKLSRTMSLSKDYDTTVHQLFPDLIKQLENEFTPKFNFNDYHIMIVHPWQLDDVLHSDY
                    ***********************************:************************

    COL             QAEVDKELIIEAKHTLDYYAGLSFRTLVPKYPAMSPHIKLSTNVHITGEIRTLSEQTTHN
    N315            QAEVDKELIIEAKHTLDYYAGLSFRTLVPKYPAMSPHIKLSTNVHITGEIRTLSEQTTHN
    NCTC8325        QAEVDKELIIEAKHTLDYYAGLSFRTLVPKYPAMSPHIKLSTNVHITGEIRTLSEQTTHN
    Newman          QAEVDKELIIEAKHTLDYYAGLSFRTLVPKYPAMSPHIKLSTNVHITGEIRTLSEQTTHN
    USA300_FPR3757  QAEVDKELIIEAKHTLDYYAGLSFRTLVPKYPAMSPHIKLSTNVHITGEIRTLSEQTTHN
                    ************************************************************

    COL             GPLMTRILNDILEKDVIFKSYASTIIDEVAGIHFYNEQDEADYQTERSEQLGTLFRKNIY
    N315            GPLMTRILNDILEKDVIFKSYASTIIDEVAGIHFYNEQDEVDYQTERSEQLGTLFRKNIY
    NCTC8325        GPLMTRILNDILEKDVIFKSYASTIIDEVAGIHFYNEQDEADYQTERSEQLGTLFRKNIY
    Newman          GPLMTRILNDILEKDVIFKSYASTIIDEVAGIHFYNEQDEADYQTERSEQLGTLFRKNIY
    USA300_FPR3757  GPLMTRILNDILEKDVIFKSYASTIIDEVAGIHFYNEQDEADYQTERSEQLGTLFRKNIY
                    ****************************************.*******************

    COL             QMIPQEVTPLIPSSLVATYPFNNESPIVTLIKRYQSAASLSDFESSAKSWVETYSKALLG
    N315            QMIPQEVTPMIPSSLVATYPFNNESPIVTLIKRYQSAASLSDFESSAKSWIETYSKALLG
    NCTC8325        QMIPQEVTPLIPSSLVATYPFNNESPIVTLIKRYQSAASLSDFESSAKSWVETYSKALLG
    Newman          QMIPQEVTPLIPSSLVATYPFNNESPIVTLIKRYQSAASLSDFESSAKSWVETYSKALLG
    USA300_FPR3757  QMIPQEVTPLIPSSLVATYPFNNESPIVTLIKRYQSAASLSDFESSAKSWVETYSKALLG
                    *********:****************************************:*********

    COL             LVIPLVTKYGIALEAHLQNAIATFRKDGLLDTMYIRDFEGLRIDKAQLNEMGYSTSHFHE
    N315            LVIPLVTKYGIALEAHLQNAIATFRKDGLLDTMYIRDFEGLRIDKAQLNEMGYSTSHFHE
    NCTC8325        LVIPLVTKYGIALEAHLQNAIATFRKDGLLDTMYIRDFEGLRIDKAQLNEMVYSTSHFHE
    Newman          LVIPLVTKYGIALEAHLQNAIATFRKDGLLDTMYIRDFEGLRIDKAQLNEMGYSTSHFHE
    USA300_FPR3757  LVIPLVTKYGIALEAHLQNAIATFRKDGLLDTMYIRDFEGLRIDKAQLNEMGYSTSHFHE
                    *************************************************** ********

    COL             KSRILTDSKTSVFNKAFYSTVQNHLGELILTISKASNDSNLERHMWYIVRDVLDNIFDQL
    N315            KSRILTDSKTSVFNKAFYSTVQNHLGELILTISKASNDSNLERHMWYIVRDVLDNIFDQL
    NCTC8325        KSRILTDSKTSVFNKAFYSTVQNHLGELILTISKASNDSNLERHMWYIVRDVLDNIFDQL
    Newman          KSRILTDSKTSVFNKAFYSTVQNHLGELILTISKASNDSNLERHMWYIVRDVLDNIFDQL
    USA300_FPR3757  KSRILTDSKTSVFNKAFYSTVQNHLGELILTISKASNDSNLERHMWYIVRDVLDNIFDQL
                    ************************************************************

    COL             VLSTHKSNQVNENRINEIKDTMFAPFIDYKCVTTMRLEDEAHHYTYIKVNNPLYRENN
    N315            VLSTHKSNQVNENRINEIKDTMFAPFIDYKCVTTMRLEDEAHHYTYIKVNNPLYRENN
    NCTC8325        VLSTHKSNQVNENRINEIKDTMFAPFIDYKCVTTMRLEDEAHHYTYIKVNNPLYRENN
    Newman          VLSTHKSNQVNENRINEIKDTMFAPFIDYKCVTTMRLEDEAHHYTYIKVNNPLYRENN
    USA300_FPR3757  VLSTHKSNQVNENRINEIKDTMFAPFIDYKCVTTMRLEDEAHHYTYIKVNNPLYRENN
                    **********************************************************