From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005578000
  • symbol?: asp23
  • description?: alkaline shock protein 23

      descriptions from strain specific annotations:

    • alkaline shock protein 23
    • Asp23/Gls24 family envelope stress response protein
  • strand?: -
  • coordinates?: 5718232..5718741
  • synteny block?: BlockID0043380
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1984 (asp23)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    SAUSA300_2142 (asp23)
    04-02981:
    SA2981_2120 (asp23)
    08BA02176:
    C248_2220 (asp23)
    11819-97:
    MS7_2205 (asp23)
    71193:
    ST398NM01_2242
    ECT-R 2:
    ECTR2_2043
    ED133:
    SAOV_2229c
    ED98:
    SAAV_2243
    HO 5096 0412:
    SAEMRSA15_20870 (asp23)
    JH1:
    SaurJH1_2252
    JH9:
    SaurJH9_2213
    JKD6008:
    SAA6008_02223
    JKD6159:
    SAA6159_02093
    LGA251:
    SARLGA251_19770 (asp23)
    M013:
    M013TW_2148
    MRSA252:
    SAR2273 (asp23)
    MSHR1132:
    SAMSHR1132_20140
    MSSA476:
    SAS2083
    Mu3:
    SAHV_2166 (asp23)
    Mu50:
    SAV2182 (asp23)
    MW2:
    MW2108 (asp23)
    RF122:
    SAB2063c (asp23)
    ST398:
    SAPIG2242
    T0131:
    SAT0131_02355 (memB)
    TCH60:
    HMPREF0772_11009 (asp)
    TW20:
    SATW20_23200 (asp23)
    USA300_TCH1516:
    USA300HOU_2175 (asp23)
    VC40:
    SAVC_09800

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTVDNNKAKQAYDNQTGVNEKEREERQKQQEQNQEPQFKNKLTFSDEVVEKIAGIAAREV
    N315            MTVDNNKAKQAYDNQTGVNEKEREERQKQQEQNQEPQFKNKLTFSDEVVEKIAGIAAREV
    NCTC8325        MTVDNNKAKQAYDNQTGVNEKEREERQKQQEQNQEPQFKNKLTFSDEVVEKIAGIAAREV
    Newman          MTVDNNKAKQAYDNQTGVNEKEREERQKQQEQNQEPQFKNKLTFSDEVVEKIAGIAAREV
    USA300_FPR3757  MTVDNNKAKQAYDNQTGVNEKEREERQKQQEQNQEPQFKNKLTFSDEVVEKIAGIAAREV
                    ************************************************************

    COL             KGILDMKGGLTDTFTNAFSSGNNVTQGVSVEVGEKQAAVDLKVILEYGESAPKIFRKVTE
    N315            KGILDMKGGLTDTFTNAFSSGNNVTQGVSVEVGEKQAAVDLKVILEYGESAPKIFRKVTE
    NCTC8325        KGILDMKGGLTDTFTNAFSSGNNVTQGVSVEVGEKQAAVDLKVILEYGESAPKIFRKVTE
    Newman          KGILDMKGGLTDTFTNAFSSGNNVTQGVSVEVGEKQAAVDLKVILEYGESAPKIFRKVTE
    USA300_FPR3757  KGILDMKGGLTDTFTNAFSSGNNVTQGVSVEVGEKQAAVDLKVILEYGESAPKIFRKVTE
                    ************************************************************

    COL             LVKEQVKYITGLDVVEVNMQVDDVMTQKEWKQKHEKNNENNNQERQGLQ
    N315            LVKEQVKYITGLDVVEVNMQVDDVMTQKEWKQKHEKNNENNNQERQGLQ
    NCTC8325        LVKEQVKYITGLDVVEVNMQVDDVMTQKEWKQKHEKNNENNNQERQGLQ
    Newman          LVKEQVKYITGLDVVEVNMQVDDVMTQKEWKQKHEKNNENNNQERQGLQ
    USA300_FPR3757  LVKEQVKYITGLDVVEVNMQVDDVMTQKEWKQKHEKNNENNNQERQGLQ
                    *************************************************