From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005587000
  • symbol?: lacF
  • description?: lactose-specific phosphotransferase enzyme IIA component

      descriptions from strain specific annotations:

    • lactose-specific phosphotransferase enzyme IIA component
    • PTS system, lactose-specific IIA component
    • PTS system lactose-specific transporter subunit IIA
    • lactose-specific phosphotransferase enzyme iia component (pts system lactose-specific eiia component) (eiia-lac) (eiii-lac)
    • PTS system lactose/cellobiose-specific IIA component
    • PTS system lactose transporter subunit IIA
  • strand?: -
  • coordinates?: 5728950..5729264
  • synteny block?: BlockID0043470
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2182 (lacF)
    N315:
    SA1993 (lacF)
    NCTC8325:
    Newman:
    NWMN_2095 (lacF)
    USA300_FPR3757:
    04-02981:
    SA2981_2129 (lacF)
    08BA02176:
    C248_2229 (lacF)
    11819-97:
    MS7_2214 (lacF)
    71193:
    ST398NM01_2251
    ECT-R 2:
    ECTR2_2052 (lacF)
    ED133:
    SAOV_2238c
    ED98:
    SAAV_2252 (lacF)
    HO 5096 0412:
    SAEMRSA15_20960 (lacF)
    JH1:
    SaurJH1_2261
    JH9:
    SaurJH9_2222
    JKD6008:
    SAA6008_02232
    JKD6159:
    SAA6159_02102
    LGA251:
    SARLGA251_19860 (lacF)
    M013:
    M013TW_2157
    MRSA252:
    SAR2282 (lacF)
    MSHR1132:
    SAMSHR1132_20230
    MSSA476:
    SAS2092
    Mu3:
    SAHV_2175 (lacF)
    Mu50:
    SAV2191 (lacF)
    MW2:
    MW2117 (lacF)
    RF122:
    SAB2072c (lacF)
    ST398:
    SAPIG2251
    T0131:
    SAT0131_02365
    TCH60:
    HMPREF0772_11000 (lacF)
    TW20:
    SATW20_23290 (lacF)
    USA300_TCH1516:
    USA300HOU_2184 (lacF)
    VC40:
    SAVC_09845 (lacF)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNREEVQLLGFEIVAFAGDARSKFLEALTAAQAGDFAKADALIEEGNNCIAEAHRAQTSL
    N315            MNREEVQLLGFEIVAFAGDARSKFLEALTAAQAGDFAKADALIEEGNNCIAEAHRAQTSL
    NCTC8325        MNREEVQLLGFEIVAFAGDARSKFLEALTAAQAGDFAKADALIEEGNNCIAEAHRAQTSL
    Newman          MNREEVQLLGFEIVAFAGDARSKFLEALTAAQAGDFAKADALIEEGNNCIAEAHRAQTSL
    USA300_FPR3757  MNREEVQLLGFEIVAFAGDARSKFLEALTAAQAGDFAKADALIEEGNNCIAEAHRAQTSL
                    ************************************************************

    COL             LAKEAQGDDIAYSVTMMHGQDHLMTTILLKDLMKHLLEFYKRG
    N315            LAKEAQGDDIAYSVTMMHGQDHLMTTILLKDLMKHLLEFYKRG
    NCTC8325        LAKEAQGDDIAYSVTMMHGQDHLMTTILLKDLMKHLLEFYKRG
    Newman          LAKEAQGDDIAYSVTMMHGQDHLMTTILLKDLMKHLLEFYKRG
    USA300_FPR3757  LAKEAQGDDIAYSVTMMHGQDHLMTTILLKDLMKHLLEFYKRG
                    *******************************************