From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005592000
  • symbol?: lacA
  • description?: galactose-6-phosphate isomerase subunit LacA

      descriptions from strain specific annotations:

    • galactose-6-phosphate isomerase subunit LacA
    • Galactose-6-phosphate isomerase, LacA subunit
    • Galactose-6-phosphate isomerase lacA subunit
  • strand?: -
  • coordinates?: 5731747..5732175
  • synteny block?: BlockID0043520
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1997 (lacA)
    NCTC8325:
    Newman:
    NWMN_2099 (lacA)
    USA300_FPR3757:
    04-02981:
    SA2981_2133 (lacA)
    08BA02176:
    C248_2233 (lacA)
    11819-97:
    MS7_2218 (lacA)
    71193:
    ST398NM01_2255
    ECT-R 2:
    ECTR2_2056 (lacA)
    ED133:
    SAOV_2242c
    ED98:
    SAAV_2256
    HO 5096 0412:
    SAEMRSA15_21000 (lacA)
    JH1:
    SaurJH1_2265
    JH9:
    SaurJH9_2226
    JKD6008:
    SAA6008_02236 (lacA)
    JKD6159:
    SAA6159_02106 (lacA)
    LGA251:
    SARLGA251_19900 (lacA)
    M013:
    M013TW_2163
    MRSA252:
    SAR2286 (lacA)
    MSHR1132:
    SAMSHR1132_20270
    MSSA476:
    SAS2096
    Mu3:
    SAHV_2179 (lacA)
    Mu50:
    SAV2195 (lacA)
    MW2:
    MW2121 (lacA)
    RF122:
    SAB2076c (lacA)
    ST398:
    SAPIG2255 (lacA)
    T0131:
    SAT0131_02369 (qoxD)
    TCH60:
    HMPREF0772_10996 (lacA2)
    TW20:
    SATW20_23330 (lacA)
    USA300_TCH1516:
    USA300HOU_2188 (lacA)
    VC40:
    SAVC_09865 (lacA)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAIIIGSDEAGKRLKEVIKSYLLDNKYDVVDVTEGQEVDFVDATLAVAKDVQSQEGNLGI
    N315            MAIIIGSDEAGKRLKEVIKSYLLDNKYDVVDVTEGQEVDFVDATLAVAKDVQSQEGNLGI
    NCTC8325        MAIIIGSDEAGKRLKEVIKSYLLDNKYDVVDVTEGQEVDFVDATLAVAKDVQSQEGNLGI
    Newman          MAIIIGSDEAGKRLKEVIKSYLLDNKYDVVDVTEGQEVDFVDATLAVAKDVQSQEGNLGI
    USA300_FPR3757  MAIIIGSDEAGKRLKEVIKSYLLDNKYDVVDVTEGQEVDFVDATLAVAKDVQSQEGNLGI
                    ************************************************************

    COL             VIDAFGAGSFMVATKIKGMIAAEVSDERSGYMTRGHNNSRMITMGSEIVGDTLAKNVVKG
    N315            VIDAFGAGSFMVATKIKGMIAAEVSDERSGYMTRGHNNSRMITMGSEIVGDTLAKNVVKG
    NCTC8325        VIDAFGAGSFMVATKIKGMIAAEVSDERSGYMTRGHNNSRMITMGSEIVGDTLAKNVVKG
    Newman          VIDAFGAGSFMVATKIKGMIAAEVSDERSGYMTRGHNNSRMITMGSEIVGDTLAKNVVKG
    USA300_FPR3757  VIDAFGAGSFMVATKIKGMIAAEVSDERSGYMTRGHNNSRMITMGSEIVGDTLAKNVVKG
                    ************************************************************

    COL             FVEGKYDGGRHQIRVDMLNKMC
    N315            FVEGKYDGGRHQIRVDMLNKMC
    NCTC8325        FVEGKYDGGRHQIRVDMLNKMC
    Newman          FVEGKYDGGRHQIRVDMLNKMC
    USA300_FPR3757  FVEGKYDGGRHQIRVDMLNKMC
                    **********************