From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005611000
  • symbol?:
  • description?: peptidase M23

      descriptions from strain specific annotations:

    • peptidase M23
    • M23/M37 peptidase domain-containing protein
    • M23/M37 familypeptidase
    • M23/M37 peptidase domain protein
    • M23B subfamily peptidase
    • membrane-bound metalloendopeptidase
    • Peptidase, M23/M37 family
    • peptidase family M23/M37 protein
    • peptidase family M23 family protein
    • peptidase M23B
    • peptidase M23 family protein
    • peptidoglycan-specific endopeptidase, M23 family
  • strand?: -
  • coordinates?: 5743404..5744103
  • synteny block?: BlockID0043700
  • occurrence?: in 81% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2140
    08BA02176:
    C248_2245
    11819-97:
    MS7_2225
    71193:
    ST398NM01_2263
    ECT-R 2:
    ECTR2_2064
    ED133:
    SAOV_2248c
    ED98:
    SAAV_2264
    HO 5096 0412:
    SAEMRSA15_21080
    JH1:
    SaurJH1_2272
    JH9:
    SaurJH9_2233
    JKD6008:
    SAA6008_02244
    JKD6159:
    LGA251:
    SARLGA251_19970
    M013:
    MRSA252:
    SAR2293
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_2187
    Mu50:
    SAV2203
    MW2:
    RF122:
    ST398:
    SAPIG2263
    T0131:
    SAT0131_02379 (purK)
    TCH60:
    HMPREF0772_10988
    TW20:
    SATW20_23410
    USA300_TCH1516:
    USA300HOU_2198
    VC40:
    SAVC_09905

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKTNFGAYLNKSKSRKIYKIFDQNLKREFSYWQFRKLFKSYTRQSDVHELKVCTQNDGT
    N315            MNKTNFGDYLNKSKSRKIYKIFDQNLKREFSYWQFRKLFKSYTRQSDVHELKVCTQNDDT
    NCTC8325        MNKTNFGAYLNKSKSRKIYKIFDQNLKREFSYWQFRKLFKSYTRQSDVHELKVCTQNDGT
    Newman          MNKTNFGAYLNKSKSRKIYKIFDQNLKREFSYWQFRKLFKSYTRQSDVHELKVCTQNDGT
    USA300_FPR3757  MNKTNFGAYLNKSKSRKIYKIFDQNLKREFSYWQFRKLFKSYTRQSDVHELKVCTQNDGT
                    ******* **************************************************.*

    COL             IEQIWIDEANQFGVSVTWKDNSIIGFVMRPLINYDAIKNETTLKYAVPTTDCYEIFWGGD
    N315            MEQIWIDKANQFGVAVTWKDNSIIGFVMRPLINYDAIKNETTLKYAVPTTDCYEVFWGGD
    NCTC8325        IEQIWIDEANQFGVSVTWKDNSIIGFVMRPLINYDAIKNETTLKYAVPTTDCYEIFWGGD
    Newman          IEQIWIDEANQFGVSVTWKDNSIIGFVMRPLINYDAIKNETTLKYAVPTTDCYEIFWGGD
    USA300_FPR3757  IEQIWIDEANQFGVSVTWKDNSIIGFVMRPLINYDAIKNETTLKYAVPTTDCYEIFWGGD
                    :******:******:***************************************:*****

    COL             NELYNYHYLYPHQRYAIDLVIKENHKTYKNQGKVNTDYFCFGKDIIAPANGTVEKVVNGV
    N315            NELYNYHYLYLHQRYAIDLVIKENHKTYKNQGKVNTDYFCFGKDIIAPANGTVEKVVNGV
    NCTC8325        NELYNYHYLYPHQRYAIDLVIKENHKTYKNQGKVNTDYFCFGKDIIAPANGTVEKVVNGV
    Newman          NELYNYHYLYPHQRYAIDLVIKENHKTYKNQGKVNTDYFCFGKDIIAPANGTVEKVVNGV
    USA300_FPR3757  NELYNYHYLYPHQRYAIDLVIKENHKTYKNQGKVNTDYFCFGKDIIAPANGTVEKVVNGV
                    ********** *************************************************

    COL             QDNSIGSTNESQFLGNYIVIKHAENEYSLIAHLHQYSIIVNEGQNVKYGDIIGKVGNSGN
    N315            QDNSIGSTNESQFLGNYIVIKHAENEYSLIAHLQQYSIIVNEGQNVKYGDFLGKVGNSGN
    NCTC8325        QDNSIGSTNESQFLGNYIVIKHAENEYSLIAHLHQYSIIVNEGQNVKYGDIIGKVGNSGN
    Newman          QDNSIGSTNESQFLGNYIVIKHAENEYSLIAHLHQYSIIVNEGQNVKYGDIIGKVGNSGN
    USA300_FPR3757  QDNSIGSTNESQFLGNYIVIKHAENEYSLIAHLHQYSIIVNEGQNVKYGDIIGKVGNSGN
                    *********************************:****************::********

    COL             STEPHIHFQVMNDKNIEACTSLKIRFINNRELIKGDVVCGLQAE
    N315            STEPHIHFQVMNDKNIEACTSLKIRFLNNLELIKGDVVCGLQGE
    NCTC8325        STEPHIHFQVMNDKNIEACTSLKIRFINNRELIKGDVVCGLQAE
    Newman          STEPHIHFQVMNDKNIEACTSLKIRFINNRELIKGDVVCGLQAE
    USA300_FPR3757  STEPHIHFQVMNDKNIEACTSLKIRFINNRELIKGDVVCGLQAE
                    **************************:** ************.*