From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005620000
  • symbol?:
  • description?: Hydrolase (HAD superfamily)

      descriptions from strain specific annotations:

    • Hydrolase (HAD superfamily)
    • HAD-superfamily hydrolase, subfamily IIB family protein
    • HAD family hydrolase
    • HAD family phosphatase
    • putative hydrolase
    • HAD hydrolase, family IIB protein
  • strand?: -
  • coordinates?: 5754897..5755716
  • synteny block?: BlockID0043740
  • occurrence?: in 81% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2141
    08BA02176:
    C248_2247
    11819-97:
    MS7_2232
    71193:
    ST398NM01_2265
    ECT-R 2:
    ECTR2_2065
    ED133:
    SAOV_2249c
    ED98:
    SAAV_2265
    HO 5096 0412:
    SAEMRSA15_21110
    JH1:
    SaurJH1_2273
    JH9:
    SaurJH9_2234
    JKD6008:
    SAA6008_02245
    JKD6159:
    LGA251:
    SARLGA251_19980
    M013:
    MRSA252:
    SAR2294
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_2188
    Mu50:
    SAV2204
    MW2:
    RF122:
    ST398:
    SAPIG2265
    T0131:
    SAT0131_02380
    TCH60:
    HMPREF0772_10987
    TW20:
    SATW20_23420
    USA300_TCH1516:
    USA300HOU_2199
    VC40:
    SAVC_09910

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSKRLLLFDFDETYFKHNTNEEDLSHLREMEKLLEKLTNNNEVITAVLTGSTFQSVMDKM
    N315            MSKRLLLFDFDETYFKHNTNEEDLSHLREMEKLLEKLTNNNEVITAVLTGSTFQSVMDKM
    NCTC8325        MSKRLLLFDFDETYFKHNTNEEDLSHLREMEKLLEKLTNNNEVITAVLTGSTFQSVMDKM
    Newman          MSKRLLLFDFDETYFKHNTNEEDLSHLREMEKLLEKLTNNNEVITAVLTGSTFQSVMDKM
    USA300_FPR3757  MSKRLLLFDFDETYFKHNTNEEDLSHLREMEKLLEKLTNNNEVITAVLTGSTFQSVMDKM
                    ************************************************************

    COL             DQVNMTFKPLHIFSDLSSKMFTWNNGEYVESETYKKKVLSEPFLFEDIEDILRHISAQYN
    N315            DQVNMTFKPLHIFSDLSSKMFTWNNGEYVESETYKKKVLSEPFLFEDIEDILRHISAQYN
    NCTC8325        DQVNMTFKPLHIFSDLSSKMFTWNNGEYVESETYKKKVLSEPFLFEDIEDILRHISAQYN
    Newman          DQVNMTFKPLHIFSDLSSKMFTWNNGEYVESETYKKKVLSEPFLFEDIEDILRHISAQYN
    USA300_FPR3757  DQVNMTFKPLHIFSDLSSKMFTWNNGEYVESETYKKKVLSEPFLFEDIEDILRHISAQYN
                    ************************************************************

    COL             VEFIPQRAFEGNETHYNFYFHSTGNHNNDSRILEALVRYANDQNYTARFSRSNPLAGDPE
    N315            VEFIPQRAFEGNETHYNFYFHSTGNHNNDSRILEALVRYANDQNYTARFSRSNPLAGDPE
    NCTC8325        VEFIPQRAFEGNETHYNFYFHSTGNHNNDSRILEALVRYANDQNYTARFSRSNPLAGDPE
    Newman          VEFIPQRAFEGNETHYNFYFHSTGNHNNDSRILEALVRYANDQNYTARFSRSNPLAGDPE
    USA300_FPR3757  VEFIPQRAFEGNETHYNFYFHSTGNHNNDSRILEALVRYANDQNYTARFSRSNPLAGDPE
                    ************************************************************

    COL             NAYDIDFTPSNAGKLYATQFLMRKYNIPVKSILGFGDSGNDEAYLSYLEHAYLMSNSRDE
    N315            NAYDIDFTPSNAGKLYATQFLMKKYNIPVKSILGFGDSGNDEAYLSYLEHAYLMSNSRDE
    NCTC8325        NAYDIDFTPSNAGKLYATQFLMRKYNIPVKSILGFGDSGNDEAYLSYLEHAYLMSNSRDE
    Newman          NAYDIDFTPSNAGKLYATQFLMRKYNIPVKSILGFGDSGNDEAYLSYLEHAYLMSNSRDE
    USA300_FPR3757  NAYDIDFTPSNAGKLYATQFLMRKYNIPVKSILGFGDSGNDEAYLSYLEHAYLMSNSRDE
                    **********************:*************************************

    COL             ALKQKFRLTKYPYYQGITLHVKEFVEGKYDY
    N315            ALKQKFRLTKYPYYQGITLHVKEFVEGKYDY
    NCTC8325        ALKQKFRLTKYPYYQGITLHVKEFVEGKYDY
    Newman          ALKQKFRLTKYPYYQGITLHVKEFVEGKYDY
    USA300_FPR3757  ALKQKFRLTKYPYYQGITLHVKEFVEGKYDY
                    *******************************