From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005623000
  • symbol?:
  • description?: toxin

      descriptions from strain specific annotations:

    • toxin
    • truncated MHC class II analog protein
    • surface protein
    • exported protein
    • extracellular adherence protein Eap
    • MAP domain-containing protein
    • MAP domain protein
    • outer membrane protein
    • pseudogene
    • surface protein, putative
    • Truncated cell surface protein map-w
  • strand?: +
  • coordinates?: 5759627..5760052
  • synteny block?: BlockID0043760
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2142 (map-w)
    08BA02176:
    C248_2248
    11819-97:
    MS7_2233
    71193:
    ST398NM01_2266
    ECT-R 2:
    ECTR2_2066
    ED133:
    SAOV_2250
    ED98:
    SAAV_2266
    HO 5096 0412:
    SAEMRSA15_21120
    JH1:
    SaurJH1_2274
    JH9:
    SaurJH9_2235
    JKD6008:
    SAA6008_02246
    JKD6159:
    SAA6159_02117
    LGA251:
    SARLGA251_19990
    M013:
    M013TW_2172
    MRSA252:
    SAR2295
    MSHR1132:
    SAMSHR1132_20360
    MSSA476:
    SAS2104
    Mu3:
    SAHV_2189
    Mu50:
    SAV2205
    MW2:
    MW2130
    RF122:
    SAB2085
    ST398:
    SAPIG2266
    T0131:
    SAT0131_02381
    TCH60:
    HMPREF0772_10986
    TW20:
    SATW20_23430
    USA300_TCH1516:
    USA300HOU_2200
    VC40:
    SAVC_09915

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKLKSFVTATLALGLLSTVGAALPSHEASADSNNGYKEMTVDGYHTVPYTISVDGITALH
    N315            MKLKSFVTATLALGLLSTVGAALPSHEASADSNNGYKELTMDGKHTVPYTISVDGITALH
    NCTC8325        MKLKSFVTATLALGLLSTVGAALPSHEASADSNNGYKEMTVDGYHTVPYTISVDGITALH
    Newman          MKLKSFVTATLALGLLSTVGAALPSHEASADSNNGYKEMTVDGYHTVPYTISVDGITALH
    USA300_FPR3757  MKLKSFVTATLALGLLSTVGAALPSHEASADSNNGYKEMTVDGYHTVPYTISVDGITALH
                    **************************************:*:** ****************

    COL             RTYFIFPENKNVLYQEIDSKVKNELASQRGVTTEKINNAQTATYTLTLNDGNKKVVNLKK
    N315            RTYFVFPENKKVLYQEIDSKVKNELASQRGVTTEKINNAQTATYTLTLNDGNKKVVNLKK
    NCTC8325        RTYFIFPENKNVLYQEIDSKVKNELASQRGVTTEKINNAQTATYTLTLNDGNKKVVNLKK
    Newman          RTYFIFPENKNVLYQEIDSKVKNELASQRGVTTEKINNAQTATYTLTLNDGNKKVVNLKK
    USA300_FPR3757  RTYFIFPENKNVLYQEIDSKVKNELASQRGVTTEKINNAQTATYTLTLNDGNKKVVNLKK
                    ****:*****:*************************************************

    COL             NDDAKNSIDPSTIKQIQIVVK
    N315            NDDAKNSIDPSTIKQIQIVVK
    NCTC8325        NDDAKNSIDPSTIKQIQIVVK
    Newman          NDDAKNSIDPSTIKQIQIVVK
    USA300_FPR3757  NDDAKNSIDPSTIKQIQIVVK
                    *********************